IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation 33 proteins were copurified and identified for interaction with hcfc1, but only some are presented in this paper. The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu herr@cshl.edu Genes Dev. (0890-9369) 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1. Genes Dev. (0890-9369) 2003 Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Wysocka J., Myers MP., Laherty CD., Eisenman RN., Herr W. Chromatin - Epigenetic interactions resulting in chromatin modulation The hcfc1-N fragment is overexpressed and the others are endogenous proteins. This experiment was performed to show the association of the N-terminally flag-tagged HCFC1 subunit (AA 2-1011) with endogenous HCFC1 subunits, OGT and specifically with the components of the Sin3 histone deacetylase (HDAC) complex (Sin3A, Sin3B and SDS3). Two-step purification for hcfc1 associated proteins using HeLa cells expressing FLAG-tagged hcfc1 N-terminus: (1) Wheat germ agglutinin beads (WGA) which binds to N-acetylglucosamine. It can then purify hcfc1 which is the most abundant protein with an O-linked-N-acetylglucosamine modification when overexpressed. (2) anti-FLAG M2 column. Fig. 2A and 2B herr@cshl.edu Genes Dev. (0890-9369) 2003 hcfc1_human Host cell factor 1 HCFC1 HCF1 C1 factor VP16 accessory protein VCAF CFF HFC1 protein protein human Homo sapiens Human MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSVPANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVPGSSISVPTAARTQGVPAVLKVTGPQATTGTPLVTMRPASQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSSPQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPVMVSNPATRMLKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKTITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQAGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPGQPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGHSTSASLATPITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQVTLITAPSGVEAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCETHETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSATSTTMTVMATGAPCSAGPLLGPSMAREPGGRSPAFVQLAPLSSKVRLSSPSIKDLPAGRHSHAVSTAAMTRSSVGAGEPRMAPVCESLQGGSPSTTVTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNPPCETHETGTTHTATTATSNGGTGQPEGGQQPPAGRPCETHQTTSTGTTMSVSVGALLPDATSSHRTVESGLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNMSSNQDPPPAASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPPPEELQVSPGPRQQLPPRQLLQSASTALMGESAEVLSASQTPELPAAVDLSSTGEPSSGQESAGSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQATTIPIVLTQQELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTVPSTVALLPSTATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPPPSKAPMKKENQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQAGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADGQ 0B0C581E2454631E rbbp4_human Histone-binding protein RBBP4 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 RBBP4 RBAP48 protein protein human Homo sapiens Human MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS DIP protein Q09028 original sequence version: 151 DIP protein Q09028 original sequence version: 111 DIP protein Q09028 original sequence version: 116 DIP protein Q09028-1 original sequence version: 130 DIP protein Q09028 original sequence version: 149 DIP protein Q09028 original sequence version: 159 DIP protein Q09028 original sequence version: 131 B71E2D55A444C360 wdr5_human WD repeat-containing protein 5 BMP2-induced 3-kb gene protein WDR5 BIG3 protein protein human Homo sapiens Human MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC DIP protein P61964 original sequence version: 35 DIP protein P61964 original sequence version: 131 DIP protein P61964 original sequence version: 83 DIP protein P61964 original sequence version: 84 DIP protein P61964 original sequence version: 87 DIP protein P61964 original sequence version: 116 DIP protein P61964 original sequence version: 130 DIP protein P61964 original sequence version: 113 DIP protein P61964 original sequence version: 112 DIP protein P61964 original sequence version: 99 4BF30914A2250286 ash2l_human Set1/Ash2 histone methyltransferase complex subunit ASH2 ASH2-like protein ASH2L ASH2L1 protein protein human Homo sapiens Human MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP DIP protein Q9UBL3 original sequence version: 50 DIP protein Q9UBL3 original sequence version: 66 DIP protein Q9UBL3 original sequence version: 86 DIP protein Q9UBL3 original sequence version: 87 DIP protein Q9UBL3-1 original sequence version: 91 DIP protein Q9UBL3 original sequence version: 119 DIP protein Q9UBL3 original sequence version: 131 DIP protein Q9UBL3 original sequence version: 103 DIP protein Q9UBL3 original sequence version: 108 DIP protein Q9UBL3 original sequence version: 143 8F5F007430D4B863 set1a_human Histone-lysine N-methyltransferase SETD1A KMT2F SET domain-containing protein 1A Set1/Ash2 histone methyltransferase complex subunit SET1 Lysine N-methyltransferase 2F SETD1A KIAA0339 SET1 SET1A protein protein human Homo sapiens Human MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDLQDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVNGSYTPQTVPTGGKALSEKFQGSGAATETAESRRRSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRRSENSYQDAFSRRHFSASSASTTASTAIAATTAATASSSASSSSLSSSSSSSSSSSSSQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEVRTSPRPASPARSGSPAPETTNESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSMVLGARDTGSEVPSGSGHGPCTPPPAPANFEDVAPTGSGEPGATRESPKANGQNQASPCSSGDDMEISDDDRGGSPPPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLIAASAGPPGGAFGEAFLPFPPPQEAAYGLPYALYAQGQEGRGAYSREAYHLPMPMAAEPLPSSSVSGEEARLPPREEAELAEGKTLPTAGTVGRVLAMLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDEDDPEQEKEAGEPGRPGTKPPKRDEERGKTQGKHRKSFALDSEGEEASQESSSEKDEEDDEEDEEDEDREEAVDTTKKETEVSDGEDEESDSSSKCSLYADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEDEEEEERPAALPSASPPPREVPVPTPAPVEVPVPERVAGSPVTPLPEQEASPARPAGPTEESPPSAPLRPPEPPAGPPAPAPRPDERPSSPIPLLPPPKKRRKTVSFSAIEVVPAPEPPPATPPQAKFPGPASRKAPRGVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRLTEEEEAEPGTEVDLAVLADLALTPARRGLPALPAVEDSEATETSDEAERPRPLLSHILLEHNYALAVKPTPPAPALRPPEPVPAPAALFSSPADEVLEAPEVVVAEAEEPKPQQLQQQREEGEEEGEEEGEEEEEESSDSSSSSDGEGALRRRSLRSHARRRRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSEDMSYLRLTYERLLQQTSGADWLNDTHWVHHTITNLTTPKRKRRPQDGPREHQTGSARSEGYYPISKKEKDKYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN DIP protein O15047 original sequence version: 84 DIP protein O15047 original sequence version: 141 DIP protein O15047 original sequence version: 140 0084217B0D425050 rbbp7_human Histone-binding protein RBBP7 RBBP7 RBAP46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein human Homo sapiens Human MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS DIP protein Q16576 original sequence version: 75 DIP protein Q16576 original sequence version: 136 DIP protein Q16576 original sequence version: 97 DIP protein Q16576 original sequence version: 102 DIP protein Q16576 original sequence version: 145 DIP protein Q16576 original sequence version: 116 DIP protein Q16576 original sequence version: 96 1A4B4CD1A8E96815 sin3a_human Paired amphipathic helix protein Sin3a SIN3A Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein human Homo sapiens Human MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q96ST3 original sequence version: 128 DIP protein Q96ST3 original sequence version: 147 E6A329BE0EAD84CD sp1_human Transcription factor Sp1 SP1 TSFP1 protein protein human Homo sapiens Human MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF DIP protein P08047 original sequence version: 185 DIP protein P08047 original sequence version: 187 DIP protein P08047 original sequence version: 181 DIP protein P08047 original sequence version: 162 DIP protein P08047 original sequence version: 161 43893DBF6518B9EA ogt1_human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit O-linked N-acetylglucosamine transferase 110 kDa subunit O-GlcNAc transferase subunit p110 OGT protein protein human Homo sapiens Human MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA DIP protein O15294 original sequence version: 165 DIP protein O15294 original sequence version: 147 852ED68BDDE63363 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 sin3b_human Paired amphipathic helix protein Sin3b Transcriptional corepressor Sin3b Histone deacetylase complex subunit Sin3b SIN3B KIAA0700 protein protein human Homo sapiens Human MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLTSQENSHNHGDGAEDFKQQVPYKEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKELDHWTLLQGSWTDDYCMSKFKNTCWIPGYSAGVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQRRAIYRIYGDKAPEIIESLKKNPVTAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDDVYSLFFANNNWYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHLVSDDVCLKVVELYLNEKKRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRKGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGTEGASSSPTEGFLLKPVFLQRNLKKFRRRWQSEQARALRGEARSSWKRLVGVESACDVDCRFKLSTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPASP 03D3B24AF1CF40B6 hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA sds3_human Sin3 histone deacetylase corepressor complex component SDS3 Suppressor of defective silencing 3 protein homolog 45 kDa Sin3-associated polypeptide SUDS3 SAP45 SDS3 protein protein human Homo sapiens Human MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKHDEEDYVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA 10A7393B607117EB hcfc1-ogt-1 3 18 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2B hcfc1-sin3a-1 3 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2B hcfc1-sin3b-1 3 20 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2B hcfc1-hdac1-1 8 19 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain physical association physical association Shows interaction between HCFC1 and HDAC1. hcfc1-hdac2-1 8 21 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain physical association physical association Shows interaction between HCFC1 and HDAC2. hcfc1-sds3-1 3 22 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2B hcfc1-sp1-1 8 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey physical association physical association Shows interaction between HCFC1 and SP1. hcfc1-hcfc1-1 3 10 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey c-terminus binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2A HCFC1 is initially synthesized as a single large precursor which is then cleaved resulting in two stable subunits, HCFC1-N and HCFC1-C. hcfc1-sin3a-2 4 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association The SIN3A PAH1 region associates specifically with a region (AA 610-722) within the HCFC1 basic region defined as the SIN3A interaction domain. hcfc1-set1-1 6 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain physical association physical association hcfc1-ash2l-1 6 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain physical association physical association hcfc1-wdr5-1 6 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey physical association physical association hcfc1-sin3a-3 9 10 unspecified role unspecified role bait bait n-terminus hcfc1n binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus hcfc1k binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 unspecified role unspecified role prey prey physical association physical association The interaction is DNA-independant. Demonstrates that SIN3A interacts only with the basic region of HCFC1 (since no interaction was detected between the kelch domain of HCFC1 and SIN3A). hcfc1-ash2l-2 9 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain kelch domain flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain physical association physical association The interaction is DNA-independant. Demonstrates that ASH2L interacts specifically with the Kelch domain of HCFC1. hcfc1-many-1 2 15 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 13 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 16 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 22 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 19 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 12 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 21 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 18 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 17 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 14 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 10 unspecified role unspecified role prey prey c-terminus binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 10 unspecified role unspecified role bait bait n-terminus hcfc1n binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 association association Hcfc1 is initially synthesized as a single large precursor which is then cleaved resulting in two stable fragments or 'subunits' HCFC1-N and HCFC1-C. hcfc1-many-2 5 13 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 16 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 17 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 10 unspecified role unspecified role neutral component neutral component n-terminus overexpressed flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 10 unspecified role unspecified role neutral component neutral component c-terminus hcfc-c endogenous binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association Hcfc1 is initially synthesized as a single large precursor which is then cleaved resulting in two stable fragments or 'subunits' HCFC1-N and HCFC1-C. Complexes spanning from 180kDa-650kDa were detected. hcfc1-many-3 1 16 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 13 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 10 unspecified role unspecified role prey prey n-terminus hcfc1n binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 association association Hcfc1 is initially synthesized as a single large precursor which is then cleaved resulting in two stable fragments or 'subunits' HCFC1-N and HCFC1-C. All proteins are endogenous. hcfc1-many-4 7 13 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 16 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 10 unspecified role unspecified role prey prey n-terminus hcfc1n binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 association association Sin3A and Ash2 are endogenous, Hcfc1 n-terminus is overexpressed. Demonstrates that Hcfc1 can associate with Ash2 and Sin3A simultaneously.