IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Mol. Cell. Biol. (0270-7306) 2003 imex curation Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Beta-Gal activity on x-gal plates was used to determine the strength of interaction. ++ indicated intermediate activity and +++ indicated strong activity. The mapping of dADA3 to dik was done from Flybase records. The Ada2a Rpb4 and Ada2b accessions were from the legend to figure 2. boros@nucleus.szbk.u-szeged.hu 23-MAY-2007: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Beta-Gal activity on x-gal plates was used to determine the strength of interaction. ++ indicated intermediate activity and +++ indicated strong activity. The mapping of dADA3 to dik was done from Flybase records. The Ada2a Rpb4 and Ada2b accessions were from the legend to figure 2. boros@nucleus.szbk.u-szeged.hu Accepted 2007-JUN-1 by ORCHARD. 23-MAY-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 orchard Only protein-protein interactions imex curation Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Mol. Cell. Biol. (0270-7306) 2003 imex curation Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Beta-Gal activity on x-gal plates was used to determine the strength of interaction. ++ indicated intermediate activity and +++ indicated strong activity. The mapping of dADA3 to dik was done from Flybase records. The Ada2a Rpb4 and Ada2b accessions were from the legend to figure 2. boros@nucleus.szbk.u-szeged.hu 23-MAY-2007: Contacted by JYOTI. orchard Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation boros@nucleus.szbk.u-szeged.hu Accepted 2007-JUN-1 by ORCHARD. 23-MAY-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 orchard Only protein-protein interactions imex curation Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Mol. Cell. Biol. (0270-7306) 2003 imex curation Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Beta-Gal activity on x-gal plates was used to determine the strength of interaction. ++ indicated intermediate activity and +++ indicated strong activity. The mapping of dADA3 to dik was done from Flybase records. The Ada2a Rpb4 and Ada2b accessions were from the legend to figure 2. boros@nucleus.szbk.u-szeged.hu 23-MAY-2007: Contacted by JYOTI. orchard Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila nuclear extract was chromatographed on a heparin-ultrogel column. Bound proteins were eluted from the column with stepwise elution using buffers containing 0.1, 0.24, 0.5, and 1 M KCl. boros@nucleus.szbk.u-szeged.hu Accepted 2007-JUN-1 by ORCHARD. 23-MAY-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 orchard Only protein-protein interactions imex curation Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Mol. Cell. Biol. (0270-7306) 2003 imex curation Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Beta-Gal activity on x-gal plates was used to determine the strength of interaction. ++ indicated intermediate activity and +++ indicated strong activity. The mapping of dADA3 to dik was done from Flybase records. The Ada2a Rpb4 and Ada2b accessions were from the legend to figure 2. boros@nucleus.szbk.u-szeged.hu 23-MAY-2007: Contacted by JYOTI. orchard Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila nuclear extract was chromatographed on a heparin-ultrogel column. Bound proteins were eluted from the column with stepwise elution using buffers containing 0.1, 0.24, 0.5, and 1 M KCl. The two fractions eluted at 0.24 and 0.5 M KCl were further analysed by Superose 6 column chromatography. boros@nucleus.szbk.u-szeged.hu Accepted 2007-JUN-1 by ORCHARD. 23-MAY-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 orchard Only protein-protein interactions imex curation Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Two different Drosophila ADA2 homologues are present in distinct GCN5 histone acetyltransferase-containing complexes. Mol. Cell. Biol. (0270-7306) 2003 imex curation Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Beta-Gal activity on x-gal plates was used to determine the strength of interaction. ++ indicated intermediate activity and +++ indicated strong activity. The mapping of dADA3 to dik was done from Flybase records. The Ada2a Rpb4 and Ada2b accessions were from the legend to figure 2. boros@nucleus.szbk.u-szeged.hu 23-MAY-2007: Contacted by JYOTI. orchard Only protein-protein interactions drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Muratoglu S., Georgieva S., Papai G., Scheer E., Enunlu I., Komonyi O., Cserpan I., Lebedeva L., Nabirochkina E., Udvardy A., Tora L., Boros I. Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila nuclear extract was centrifuged through a 10 to 30% glycerol gradient. boros@nucleus.szbk.u-szeged.hu Accepted 2007-JUN-1 by ORCHARD. 23-MAY-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 orchard Only protein-protein interactions imex curation taf1_drome Transcription initiation factor TFIID subunit 1 Transcription initiation factor TFIID 230 kDa subunit TAFII250 TBP-associated factor 230 kDa Taf1 TAF250 CG17603 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEMESDNSDDEGSIGNGLDLTGILFGNIDSEGRLLQDDDGEGRGGTGFDAELRENIGSLSKLGLDSMLLEVIDLKEAEPPSDDEEEEDARPSAVSASEGMSAFDALKAGVKREDGAVKAQDDAIDYSDITELSEDCPRTPPEETSTYDDLEDAIPASKVEAKLTKDDKELMPPPSAPMRSGSGGGIEEPAKSNDASSPSDDSKSTDSKDADRKLDTPLADILPSKYQNVDVRELFPDFRPQKVLRFSRLFGPGKPTSLPQIWRHVRKRRRKRNQSRDQKTTNTGGSDSPSDTEEPRKRGFSLHYAAEPTPAECMSDDEDKLLGDFNSEDVRPEGPDNGENSDQKPKVADWRFGPAQIWYDMLEVPDSGEGFNYGFKTKAASTSSQPQLKDERRVKSPEDDVEDPSIADDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKTNAAGWLPSSGSRTAGAFSQPGKPSMPVGSGSSKQGSGASSKKAQQNAQAKPAEAPDDTWYSLFPVENEELIYYKWEDEVIWDAQQVSKVPKPKVLTLDPNDENIILGIPDDIDPSKINKSTGPPPKIKIPHPHVKKSKILLGKAGVINVLAEDTPPPPPKSPDRDPFNISNDTYYTPKTEPTLRLKVGGNLIQHSTPVVELRAPFVPTHMGPMKLRAFHRPPLKKYSHGPMAQSIPHPVFPLLKTIAKKAKQREVERIASGGGDVFFMRNPEDLSGRDGDIVLAEFCEEHPPLINQVGMCSKIKNYYKRKAEKDSGPQDFVYGEVAFAHTSPFLGILHPGQCIQAIENNMYRAPIYPHKMAHNDFLVIRTRNNYWIRSVNSIYTVGQECPLYEVPGPNSKRANNFTRDFLQVFIYRLFWKSRDNPRRIRMDDIKQAFPAHSESSIRKRLKQCADFKRTGMDSNWWVIKPEFRLPSEEEIRAMVSPEQCCAYFSMIAAEQRLKDAGYGEKFLFAPQEDDDEEAQLKLDDEVKVAPWNTTRAYIQAMRGKCLLQLSGPADPTGCGEGFSYVRVPNKPTQTKEEQESQPKRSVTGTDADLRRLPLQRAKELLRQFKVPEEEIKKLSRWEVIDVVRTLSTEKAKAGEEGMDKFSRGNRFSIAEHQERYKEECQRIFDLQNRVLASSEVLSTDEAESSASEESDLEELGKNLENMLSNKKTSTQLSREREELERQELLRQLDEEHGGPSGSGGAKGAKGKDDPGQQMLATNNQGRILRITRTFRGNDGKEYTRVETVRRQPVIDAYIKIRTTKDEQFIKQFATLDEQQKEEMKREKRRIQEQLRRIKRNQERERLAQLAQNQKLQPGGMPTSLGDPKSSGGHSHKERDSGYKEVSPSRKKFKLKPDLKLKCGACGQVGHMRTNKACPLYSGMQSSLSQSNPSLADDFDEQSEKEMTMDDDDLVNVDGTKVTLSSKILKRHGGDDGKRRSGSSSGFTLKVPRDAMGKKKRRVGGDLHCDYLQRHNKTANRRRTDPVVVLSSILEIIHNELRSMPDVSPFLFPVSAKKVPDYYRVVTKPMDLQTMREYIRQRRYTSREMFLEDLKQIVDNSLIYNGPQSAYTLAAQRMFSSCFELLAEREDKLMRLEKAINPLLDDDDQVALSFIFDKLHSQIKQLPESWPFLKPVNKKQVKDYYTVIKRPMDLETIGKNIEAHRYHSRAEYLADIELIATNCEQYNGSDTRYTKFSKKILEYAQTQLIEFSEHCGQLENNIAKTQERARENAPEFDEAWGNDDYNFDRGSRASSPGDDYIDVEGHGGHASSSNSIHRSMGAEAGSSHTAPAVRKPAPPGPGEVKRGRGRPRKQRDPVEEVKSQNPVKRGRGRPRKDSLASNMSHTQAYFLDEDLQCSTDDEDDDEEEDFQEVSEDENNAASILDQGERINAPADAMDGMFDPKNIKTEIDLEAHQMAEEPIGEDDSQQVAEAMVQLSGVGGYYAQQQQDESMDVDPNYDPSDFLAMHKQRQSLGEPSSLQGAFTNFLSHEQDDNGPYNPAEASTSAASGADLGMDASMAMQMAPEMPVNTMNNGMGIDDDLDISESDEEDDGSRVRIKKEVFDDGDYALQHQQMGQAASQSQIYMVDSSNEPTTLDYQQPPQLDFQQVQEMEQLQHQVMPPMQSEQLQQQQTPQGDNDYAWTF DIP protein P51123 original sequence version: 146 DIP protein P51123 original sequence version: 113 DIP protein P51123-1 original sequence version: 147 6BF505E5A3EFF160 rpb1_drome DNA-directed RNA polymerase II subunit RPB1 RpII215 CG1554 DNA-directed RNA polymerase III largest subunit protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTPTDSKAPLRQVKRVQFGILSPDEIRRMSVTEGGVQFAETMEGGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKGKTICEGGEDMDLTKENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTVKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGESKVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFKAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAAMFIGGGSTPSMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPSWSPAHPGSSPSSPGPSMSPYFPASPSVSPSYSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPTFEESED 4EC68C7708A167A3 tbp_drome TATA-box-binding protein Tbp BTF1 TFIID CG9874 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription initiation factor TFIID TBP subunit protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGSSSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQQLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDALSNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQS DIP protein P20227 original sequence version: 134 DIP protein P20227 original sequence version: 99 DIP protein P20227 original sequence version: 135 7B079BC01BAF69BC gcn5_yeast Histone acetyltransferase GCN5 YGR252W GCN5 ADA4 SWI9 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKENKGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNIKPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID 3200730DDC7EF70D 3200730DDC7EF70D q95u32_drome Rpb7 Dmel\CG31344 anon-WO0118547.636 Dmel_CG31344 CG6572 CG31344 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQEPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNAGMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNIADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFITMGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDIVMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACVKGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYALVRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGLKDD 0F3F17154AC6AC45 tad2a_human Transcriptional adapter 2-alpha TADA2A TADA2L Transcriptional adapter 2-like KL04P protein protein human Homo sapiens Human MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPSIPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG A4E1D87B1B3F6BA5 q9vwz1_drome dAda3 CG7098 Ada3 dik Dmel_CG7098 DADA3 Dmel\CG7098 HL-XIV ADA3 dADA3 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSANLKNIKLAHFSGSLGSGGFGISASSGGAGKLPTNGTGGGKSAPTSTFLDSEVLATPGGVVIPIIRTRDVPKLLPTIAAALQRPADDHLAAEDLDAVQLELEQMLSNVALRTRVLKAEYDSLDKDEKRQDRRKLDRVPGSPPCPASMLNGLLGIGSNSSTSLGSPLGGGGASSSSQSKRKRDEPTGVRKKHSSMTILKQQGVSGGTSKHQAKNSPLVVHTDDSMDYLPTLAAANASGSVLPHHQPLPQLPKMTVPKNDTPNKFWLSVEPYCMPLTNEDLRLIDDLLEQYWGPLVPPVPPLGPHYSTVWAQEDIKALQPGGARIKSNNSSGMLKKAEGMVDESITGPLTQRLVSALMEESLMTLPSEQAAVGEHSNSTTSSSNENTHSHSSSSANAAAAAASGNFRSLAMMKHGVGIEQRLKKTLIENGLIDASEFAAHEDVDEVLMEIKRVTTEISTISQFNSEELKRLRAVASEEIKRIAIKQKLDMVDQEILECYKRMLQYRAKRKGHTIEEKQEILRLTNEQRLLADQLERMQMHLPCIGGSGNSLLEPKM 01CD4BCA2F23E9B9 taf10_drome Transcription initiation factor TFIID subunit 10 Taf10 Transcription initiation factor TFIID 24 kDa subunit dTAF(II)24 CG2859 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASDGEDISVTPAESVTSATDTEEEDIDSPLMQSELHSDEEQPDVEEVPLTTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQYFV DIP protein Q9U5W9 original sequence version: 70 8C8DDCD3BEAEA735 q7ksd8-4 Transcriptional adapter 2A Ada2a Rpb4 dADA2a CG43663 ADA2A-SV1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSFMNPVDMVDEDAADLQFPKVALLHIFTTLNCLFAVEPLGPQVKRFIHAHQNEHTRNSMVLYNPHTLHRYLEEMEEKTRDQNSSVPSATKDANRCATCRCSLTEPYIKCSECLDTLLCLQCFSRGKEAFSHRNNHAYIIVRDNIQVFADEPHWTARDERILLKTLRTHGYGNWEAVSQALDQRHEPAEVRRHYHDCYFGGIFERLLNLKHARDSYVPERMPYVFKMRSLDPPRHDDIASMQFRLSAGYRCARGDFDTPYDTSAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGLVRAYNNRLRERQRRYKIMRQHGLIMPNRTVSWISKYVHAFGSDASCMRFLGFMQICPDPIKFDMLLESLRYYRELHSQLHKLYDLREHGVRTLSGAKLYARLSKERQQAQRDYSRLKQTDAFDWQQLVQHYESNRSGDPGPLAINSKLYVMNTRRKASPIEIGDLPGYSKLDDGERKLCSVARLVPQSYLDYKNQLVTEQAKLGYLRLADARRLIKIDVNKTRQIYDFLLEHGHISRPPSYG CA76D6E8E3D471EC tafab_drome Transcription initiation factor TFIID subunit 10b Taf10b Taf16 CG3069 Transcription initiation factor TFIID 16 kDa subunit dTAF(II)16 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVGSNFGIIYHNSAGGASSHGQSSGGGGGGDRDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLAAQKYMSDIIDDALQHSKARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADYGINVRKVDYSQ 882984D4A6517991 taf4_drome Transcription initiation factor TFIID subunit 4 Transcription initiation factor TFIID 110 kDa subunit 110 kDa TBP-associated factor Taf4 TAF110 CG5444 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNTSQTAAGNRITFTSQPLPNGTISIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQQVHHVQQQQQSQQQQQQQQQTQSAGQPLLNSMLPAGVVVGMRQQAPSQQQQKNVPTNPLSRVVINSHMAGVRPQSPSITLSTLNTGQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNTSNNSNTTSTTNHPTTTQIRLQTVPAAASMTNTTATSNIIVNSVASSGYANSSQPPHLTQLNAQAPQLPQITQIQTIPAQQSQQQQVNNVSSAGGTATAVSSTTAATTTQQGNTKEKCRKFLANLIELSTREPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELVIEGIKPPPQHVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPNALGTPRPTIGHTTISKQPPNIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQHAQLQRTGSVQIRATTRPPNSVPTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPTPTLSVLSTLNSASTTTLPIPSLPTVHLPPEALRAREQMQNSLNHNSNHFDAKLVEIKAPSLHPPHMERINASLTPIGAKTMARPPPAINKAIGKKKRDAMEMDAKLNTSSGGAASAANSFFQQSSMSSMYGDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQARIRAITSEAGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDGETVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTYLK DIP protein P47825 original sequence version: 137 DIP protein P47825-1 original sequence version: 103 DIP protein P47825 original sequence version: 104 DIP protein P47825-1 original sequence version: 140 27E6852859872767 tad2b_drome Transcriptional adapter 2B dADA2b Ada2b CG9638 Ada2S protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTTIADLFTKYNCTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDTGTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQRPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFFRNRNYAQQQGLTKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQSELYRYRYNGLTKIAECTHFEQHAATATHRSTGPYGHGKTDHTHTSNGSHRPPSSSLHSPQPNLRKVEMSSGGEASSNSIAPRNTLHIADPTCSGALLPSKNYLDSCRGSSAATMLQTTGMVMGVTVDSGATTGVTSTATTMANLPTNSAKGSQQHLQPLQQHPQLLQSGNQHKMQNEAAGGGSDQVPSMSLKLRTQLEELKHLPQPPGSELLSHNELDLCKKHNITPTTYLSVKTVCLSGAPSLGSPMETSLRKFFIKCGWLSH 89079A24FF11F381 o76216_drome Histone acetyltransferase Gcn5 Pcaf CG4107 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSGGPSITIKSQPIDGNNTGNAAAQQQQQAANGAATAGASGAAGSAQNPGHGGAASGAGSVPAEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENRHRDVESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRVEDEDTKKVYQYLFRLLRQCVLTRQQAVIRGPLGDPPFETPCITKAVLSLVFYKYNHLSTPELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQCETSLVFGRTLLRTVFQCVSQQLKKKCISERDRFPEDKRSIITLMPKFLETLRAELLKDDSPIWDTSYRPSNSFVIQQRKRNQEVASVPIGPSAASIGGNKRTSVGEPLHKRIKKEPTDRPSSENLDDLPADVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDVKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKVRPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK 7983E218CBB98D93 q9vea5-1 DNA-directed RNA polymerase II subunit Rpb4 Rpb4 CG43662 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSFMNPVDMVDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADEEQEFSEVFMKTYAYTDSFRKFKNKETIMSARSLLMQKKLHKFELAALGNLCPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSLQY F7541C9A08C23CB1 q92830-2 Histone acetyltransferase KAT2A GCN5-S KAT2A GCN5 GCN5L2 General control of amino acid synthesis protein 5-like 2 Histone acetyltransferase GCN5 Lysine acetyltransferase 2A STAF97 Histone succinyltransferase KAT2A Histone glutaryltransferase KAT2A protein protein human Homo sapiens Human MGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK A6EAE20DB0B49ADC taf9_drome Transcription initiation factor TFIID subunit 9 e(y)1 TAF40 CG6474 Transcription initiation factor TFIID 42 kDa subunit TAFII40 p42 Protein enhancer of yellow 1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSAEKSDKAKISAQIKHVPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTIDLDDVRLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNYKLRATNQPKKMTKSAVEGRPLKTVVKPVSSANGPKRPHSVVAKQQVVTIPKPVIKFTTTTTTKTVGSSGGSGGGGGQEVKSESTGAGGDLKMEVDSDAAAVGSIAGASGSGAGSASGGGGGGGSSGVGVAVKREREEEEFEFVTN DIP protein Q27272 original sequence version: 125 DIP protein Q27272 original sequence version: 93 0EA442C80467001F kat2a_human Histone acetyltransferase KAT2A Histone acetyltransferase GCN5 STAF97 General control of amino acid synthesis protein 5-like 2 GCN5L2 Lysine acetyltransferase 2A KAT2A GCN5 Histone succinyltransferase KAT2A Histone glutaryltransferase KAT2A protein protein human Homo sapiens Human MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK DIP protein Q92830 original sequence version: 156 DIP protein Q92830 original sequence version: 158 728CC8ACF08600EA ada2b-pcaf 1 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score ++ Table 2 dADA2a interacts with dGCN5 but not with dADA3 whereas dADA2b interacts with both dGCN5 and dADA3. ada2a-pcaf 1 14 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score ++ Table 2 dADA2a interacts with dGCN5 but not with dADA3 whereas dADA2b interacts with both dGCN5 and dADA3. dik-ada2b 1 12 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 2 dADA2a interacts with dGCN5 but not with dADA3 whereas dADA2b interacts with both dGCN5 and dADA3. rpb4-rpb7 1 19 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score ++ Table 2 Tested whether interaction would exist between dRPB4, encoded by the alternatively spliced mRNA, and its putative partner dRPB7 (36). For this purpose, the dRPB7 cDNA was inserted in frame in the GAL4 expression vector. In the two-hybrid assay, these two Pol II subunits interacted as expected (Table 2). ada2b-gcn5 1 20 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 2 The interactions between dADA2a and hGCN5-S or dADA2b and hGCN5-S were comparable to that observed between hADA2a and hGCN5 or yADA2 and yGCN5 ada2a-gcn5 1 14 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 2 The interactions between dADA2a and hGCN5-S or dADA2b and hGCN5-S were comparable to that observed between hADA2a and hGCN5 or yADA2 and yGCN5 ada2l-gcn5 1 11 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 2 The interactions between dADA2a and hGCN5-S or dADA2b and hGCN5-S were comparable to that observed between hADA2a and hGCN5 or yADA2 and yGCN5 ada2a-gcn5-2 1 14 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 2 The interactions between dADA2a and hGCN5-S or dADA2b and hGCN5-S were comparable to that observed between hADA2a and hGCN5 or yADA2 and yGCN5 taf10-gcn5 2 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association 4A In the anti-dmTAF10 IP, dADA2b could be found associated with dmTAF10 together with GCN5 (Fig. 4A, lane 2), indicating that dADA2b is associated with a dmTAF10-containing multiprotein complex. dmTAF1 (dTAFII230), dmTAF4 (dTAFII110), dmTAF6 (dTAFII80), dmTAF9 (dTAFII40), and dTBP were specifically coimmunoprecipitated with both dmTAF10 and dmTAF10b taf10b-tbp 2 16 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 4A dmTAF1 (dTAFII230), dmTAF4 (dTAFII110), dmTAF6 (dTAFII80), dmTAF9 (dTAFII40), and dTBP were specifically coimmunoprecipitated with both dmTAF10 and dmTAF10b ada2a-gcn5-3 2 14 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association 4A IP experiments were carried out with the purified antisera raised against either dADA2a or dADA2b. Both antibodies coimmunoprecipitated dADA2b, GCN5, and TAF9 from the nuclear extract (lanes 6 and 8); however, the anti-dADA2b PAb also coimmunoprecipitated dTAF10 and dTAF4 ada2b-gcn5-1 2 21 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 4A IP experiments were carried out with the purified antisera raised against either dADA2a or dADA2b. Both antibodies coimmunoprecipitated dADA2b, GCN5, and TAF9 from the nuclear extract (lanes 6 and 8); however, the anti-dADA2b PAb also coimmunoprecipitated dTAF10 and dTAF4 ada2a-ada2b 5 14 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component physical association physical association 4B 400 - 800 kDa dADA2a in fractions containing complexes with molecular masses between 400 and 800 kDa (Fig. 4B, fractions 6 to 12) which also contained a portion of dGCN5, TAF9, TAF10, and TBP, together with detectable levels of dADA2b gcn5-ada2b-2 5 21 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component physical association physical association 4B Complex size was higher than 2 MDa. In the fractions which correspond to masses greater than 2 MDa (fractions 16 to 20), dADA2b cosedimented with the second peak of dGCN5, TBP, and all the other TAFs tested ada2a-tbp 3 14 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component association association In the ADA2a-containing Hep0.24-derived fraction, we also detected some GCN5, TAF9, and TBP. 5A, B ada2b-tbp 3 17 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component association association ADA2b-containing Hep0.5-derived fraction, we detected more GCN5 together with TAF1, TAF4, TAF9, TAF10, TAF10b, and TBP. 5A, B gcn5-ada2a-2 4 14 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association 5C ADA2a eluted from the Superose 6 column a between 0.2 and 0.7 MDa, and in fractions 14 to 17 it coeluted with GCN5 Complex size between 0.2 and 0.7 MDa Complex was a further elution from a 0.24M KCl fraction of Heparin-UG column. gcn5-ada2b-3 4 16 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association 5D ADA2b, together with the tested TAFs and GCN5, eluted from the column as a large multiprotein complex with a molecular mass larger than 2 MDa Complex size higher than 2 MDa Complex was a further elution from a 0.5M KCl fraction of Heparin-UG column.