IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. Genes Dev. (0890-9369) 2001 Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de 29-OCT-2007: Contacted by JYOTI. Yeast cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation no Interactions demonstrated in this experiment have been shown to be indirect. Interaction between SAS2 and SAS5 has been shown to be indirect therefore are annotated in a separate experiment to prevent UniProt/GOA export. ehrenhof@molgen.mpg.de Accepted 2007-JUN-22 by DAVET. 29-OCT-2007: Contacted by JYOTI. Yeast cDNA Genes Dev. (0890-9369) 2001 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. Genes Dev. (0890-9369) 2001 Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de 29-OCT-2007: Contacted by JYOTI. Yeast cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation Sephacryl S-300 gel-filtration. ehrenhof@molgen.mpg.de Accepted 2007-JUN-22 by DAVET. 29-OCT-2007: Contacted by JYOTI. Yeast cDNA Genes Dev. (0890-9369) 2001 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. Genes Dev. (0890-9369) 2001 Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de 29-OCT-2007: Contacted by JYOTI. Yeast cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de Accepted 2007-JUN-22 by DAVET. Yeast cDNA Genes Dev. (0890-9369) 2001 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. Genes Dev. (0890-9369) 2001 Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de 29-OCT-2007: Contacted by JYOTI. Yeast cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de Accepted 2007-JUN-22 by DAVET. 29-OCT-2007: Contacted by JYOTI. Yeast cDNA Genes Dev. (0890-9369) 2001 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. Genes Dev. (0890-9369) 2001 Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de 29-OCT-2007: Contacted by JYOTI. Yeast cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation Interaction between SAS2 and SAS5 has been shown to be indirect therefore are annotated in a separate experiment to prevent UniProt/GOA export. ehrenhof@molgen.mpg.de Accepted 2007-JUN-22 by DAVET. 29-OCT-2007: Contacted by JYOTI. Yeast cDNA Genes Dev. (0890-9369) 2001 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. Genes Dev. (0890-9369) 2001 Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de 29-OCT-2007: Contacted by JYOTI. Yeast cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation no Interactions demonstrated in this experiment have been shown to be indirect. Interaction between SAS2 and SAS5 has been shown to be indirect therefore are annotated in a separate experiment to prevent UniProt/GOA export. ehrenhof@molgen.mpg.de Accepted 2007-JUN-22 by DAVET. 29-OCT-2007: Contacted by JYOTI. Yeast cDNA Genes Dev. (0890-9369) 2001 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. Genes Dev. (0890-9369) 2001 Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de 29-OCT-2007: Contacted by JYOTI. Yeast cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation Interaction between SAS2 and SAS5 has been shown to be indirect therefore is annotated in a separate experiment to prevent UniProt/GOA export. ehrenhof@molgen.mpg.de Accepted 2007-JUN-22 by DAVET. 29-OCT-2007: Contacted by JYOTI. Yeast cDNA Genes Dev. (0890-9369) 2001 sas5_yeast Something about silencing protein 5 SAS5 YOR213C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDHSIEVTFRVKTQQVIIPEQNIRGNELPLRRWQMELLMLDATGKEVEPTILSKCIYHLHSSFKQPKRRLNSLPFFIKETGWGEFNLKIECFFIGNAGKFSIEHDLTFEDDAYAVDYTVDVPHEFSHLNSELSKYFDLPWKVVSPEEEMSLRIADLPWIKSLALIDEDMMTDVVQMILNDPAVQRAIENHPRREQFFMFITQLPDDLLMKIQAFLKLPNKNSTKQERTNFGSDAIHKDEPVKAHNKLK 9E2F68A040A19E0D sas4_yeast Something about silencing protein 4 SAS4 YD9395.15C YDR181C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGIFQSIEEANNTSERLLRSEIKNSHGEFEKFDFDTEEYEINPKRKLRLVSRINPNAGHLRKSKSCFTVDEHVDETRCQKPVMKSPFMSNVDDEIKKKRETITKMTLEIEHHELSQNIRKPTDDLLPDSTYQPYHKKMLKQENRMIQSDIVNGENEADRLSLISDRLGMLNWEVTLQKVTKINDPTDENEMETKRYQTKELIDSMLHKFESMKKKSRNLARRPASSDSLLKLVSGKDWPKIYTRIDRTFIPDYASSSDEEEEKITVEEIRERRLKKREQQCGGSIIVLLSDHQSQKGMTRFAIVAEPLRKPYLIKTSTKERNSWKNKVPTNPKKFKKAPRISTQIAVKRRREVIPLTMEVEPEVIRDIRQDTQKSMKLNVKAEEISVTETVKSKEMNALRNNAASISPTLSEKAPLGSISSCTASQISQRSSENVGAIINNINPNLAIVPSCNEKTFVKTHNGMKTNSGINILPVRKKKKV 71979C2084803CB2 rlf2_yeast Chromatin assembly factor 1 subunit p90 RLF2 CAC1 YPR018W YP9531.12 CAF-1 90 kDa subunit RAP1 localization factor 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQHLKSIPLQDDTKKKGILSFFQNTTTVKSNKFLTKEKDVITLDDPKEDVSGPMIETVKQETMKSINKECADEMKTTPKKANAEDKLLCYKNSPIQSTKYDRNTNKQVPNGNIIAIETKSRSSSPCSKRELSSSKKEEAKREKELKKQQRAEEKHRKELLRQEEKKKKELKVEEERQRRAELKKQKEEEKRRKEEARLEAKRRKEEERLKKEEEIRLKEEAKERAQSRIGNFFKKLSDSNTPVVEKSDYEKFFLPFYAKDGVRVSNKWKLTKVELEGSKRKIDDELLNSKDKTSSDDLLNWLQSRRLPRGHKIKRKAVDVLQQMPLKEKTDDELQSLLAQVPHKYIKFYENVRPPFIGTYSMDFTLPPNDPFSTKGTGFNYDYDSDVEWVNEEEEGEVDNLESGEEEEEEEDDEDVPSEGEFDGFLDSEENSDLDGLPCAKRKFVGPLIPTICLKSNFENLSEENKRYLQQLKAEVIIETDGPIDPFKEPKTSSLPSKRSNSDLQAQTASQSQSPEKKQKAMITDPMDLLRLFDGVQDSTFSLGTVTEIAQKNLPQYNKQTIKNTIKEYAIRSSGKGDLPRKWVIKDAQNWENLRANANMPTPSL C593E6E4FE5FD778 C593E6E4FE5FD778 sas2_yeast Histone acetyltransferase SAS2 SAS2 ESO1 YMR127C YM9553.03C Something about silencing protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARSLSQSLTATTQKLKGKKNGGKGKNKPSAKIKKTQKEMLYGILNERNIRQIQFGLNKKFSTWYGSAVYFDPETKRLGCSETKGQLSSVSNSQYWLDTLFVCEYCFKYTDDQTRFVGHVASCPFQYRVPGKIKYKSPEYTIRRVKGSKYQLFCQCLCLFTKLYLDNKSMYFKVDHYEFYIVYETGSTKPMGFFSKDLVSYQQNNLACILIFPPYQRRGLGLLLIEFSYKLSQLEGVISGPEVPLSPFGLIGYLKYWSQILCWHLIEGDLAHYDKVTLEDLSIVTGMRVNDVILTLKHLNCIGENNQIYLQSLNSWLKLHGTKRNWFKLKDEYLLIDD 22CBDC0D1B62A947 asf1_yeast Histone chaperone ASF1 ASF1 YJL115W J0755 CIA1 Anti-silencing function protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGVDDEEEEDDEEEDDDEDDEDDEDDDQEDGEGEAEEAAEEEEEEEEKTEDNETNLEEEEEDIENSDGDEEEGEEEVGSVDKNEDGNDKKRRKIEGGSTDIESTPKDAARSTN 186E76075C0B1644 186E76075C0B1644 sas2-sas4-1 3 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain physical association physical association To identify proteins that interact with Sas2, we performed a two-hybrid screen (Chien et al. 1991). One interacting clone specific for Sas2 contained a fragment of the SAS4 gene (amino acids 4-329; Table 1). Table 1 sas4-sas5-1 4 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association To identify proteins that interact with Sas2, we performed a two-hybrid screen (Chien et al. 1991). One interacting clone specific for Sas2 contained a fragment of the SAS4 gene (amino acids 4-329; Table 1). Table 1 sas2-sas4-2 4 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait P40963:p.Cys106Leu zinc finger disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C L Wed May 02 17:34:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys106leu' Tue Jun 30 17:59:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys106Leu' P40963:p.Pro213_Pro214delinsAlaVal HAT domain disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain PP AV Thu Jul 07 12:16:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro213ala_pro214val Fri Jul 22 11:01:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro213ala,pro214val' Wed May 02 20:21:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_pro213-214ala_val' Tue Jun 30 16:39:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro213_Pro214delinsAlaVal' physical association physical association Two-hybrid interactions between SAS-I components and chromatin assembly factors Table 1 sas2-sas4-3 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Two-hybrid interactions between SAS-I components and chromatin assembly factors Table 1 sas2-sas2-1 4 11 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association To identify proteins that interact with Sas2, we performed a two-hybrid screen (Chien et al. 1991). One interacting clone specific for Sas2 contained a fragment of the SAS4 gene (amino acids 4-329; Table 1). Table 1 sas2-cac1-1 4 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait P40963:p.Cys106Leu zinc finger disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C L Wed May 02 17:05:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys106leu' Tue Jun 30 18:12:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys106Leu' P40963:p.Pro213_Pro214delinsAlaVal HAT domain disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain PP AV Thu Jul 07 12:18:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro213ala_pro214val Fri Jul 22 10:50:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro213ala,pro214val' Wed May 02 16:18:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_pro213-214ala_val' Tue Jun 30 18:10:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro213_Pro214delinsAlaVal' physical association physical association Two-hybrid interactions between SAS-I components and chromatin assembly factors Table 1 sas2-asf1-1 4 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Two-hybrid interactions between SAS-I components and chromatin assembly factors Table 1 sas4-sas4-1 4 9 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Two-hybrid interactions between SAS-I components and chromatin assembly factors Table 1 sas4-asf1-1 4 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Two-hybrid interactions between SAS-I components and chromatin assembly factors Table 1 sas4-cac1-1 4 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Two-hybrid interactions between SAS-I components and chromatin assembly factors Table 1 asf1-sas5-1 4 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association To identify proteins that interact with Sas2, we performed a two-hybrid screen (Chien et al. 1991). One interacting clone specific for Sas2 contained a fragment of the SAS4 gene (amino acids 4-329; Table 1). Table 1 sas5-cac1-1 4 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association To identify proteins that interact with Sas2, we performed a two-hybrid screen (Chien et al. 1991). One interacting clone specific for Sas2 contained a fragment of the SAS4 gene (amino acids 4-329; Table 1). Table 1 sas2-sas4-4 5 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey P40963:p.Cys106Leu zinc finger disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C L Wed May 02 15:00:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys106leu' Tue Jun 30 18:45:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys106Leu' physical association physical association Sas2 coimmunoprecipitated with myc-Sas4 and HA-Sas5. 1A, 3D, 5A sas2-sas5-1 6 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Sas2 coimmunoprecipitated with myc-Sas4 and HA-Sas5. 1A sas4-sas5-2 5 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association myc-Sas4 coimmunoprecipitated with Sas2 and HA coimmunoprecipitated Sas5 1A sas4-sas5-3 5 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association For coimmunoprecipitation of myc-Sas4 with HA-Sas5, 1A sas2-sas4-5 7 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait physical association physical association For coimmunoprecipitation of myc-Sas4 with Sas2, 1A sas2-sas5-2 1 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association myc-Sas4 coimmunoprecipitated with Sas2 1A sas4-sas5-4 2 9 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To determine the apparent molecular mass of Sas2-, Sas4-, and Sas5-containing complexes in yeast, whole cell lysates of strains expressing myc-tagged versions of Sas2 and Sas4 and HA-tagged Sas5 were applied directly to a Sephacryl S-300 gel-filtration column. 1B Complex molecular mass = approx 220 kD sas2-cac1-2 3 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain physical association physical association In a two-hybrid screen with Sas2, we also identified Cac1 as an interacting partner (amino acids 80-517). sas2-cac1-3 5 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physical association physical association In coimmunoprecipitation experiments, Cac1 immunoprecipitated with both Sas2 and Sas4 (Fig. 5A). 5A sas2-cac1-4 7 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait physical association physical association In coimmunoprecipitation experiments, Cac1 immunoprecipitated with both Sas2 and Sas4 (Fig. 5A). 5A sas4-cac1-2 5 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association In coimmunoprecipitation experiments, Cac1 immunoprecipitated with both Sas2 and Sas4 (Fig. 5A). 5A sas4-cac1-3 5 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association In coimmunoprecipitation experiments, Cac1 immunoprecipitated with both Sas2 and Sas4 (Fig. 5A). 5A sas4-asf1-2 5 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Asf1 was coimmunoprecipitated with both Sas2 and Sas4 (Fig. 7A). 7A sas2-asf1-2 7 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait physical association physical association Asf1 was coimmunoprecipitated with both Sas2 and Sas4 (Fig. 7A). 7A