UniProt UniProt http://www.uniprot.org Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Genes Dev. (0890-9369) 2000 Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu 07-Aug-2007: Contacted by JYOTI. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu Accepted 2007-AUG-25 by DAVET. 07-Aug-2007: Contacted by JYOTI. Genes Dev. (0890-9369) 2000 davet Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Genes Dev. (0890-9369) 2000 Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu 07-Aug-2007: Contacted by JYOTI. davet in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu Accepted 2007-AUG-25 by DAVET. 07-Aug-2007: Contacted by JYOTI. Genes Dev. (0890-9369) 2000 davet Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Genes Dev. (0890-9369) 2000 Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu 07-Aug-2007: Contacted by JYOTI. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu Accepted 2007-AUG-25 by DAVET. 07-Aug-2007: Contacted by JYOTI. Genes Dev. (0890-9369) 2000 davet Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Ssn6-Tup1 interacts with class I histone deacetylases required for repression. Genes Dev. (0890-9369) 2000 Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu 07-Aug-2007: Contacted by JYOTI. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Watson AD., Edmondson DG., Bone JR., Mukai Y., Yu Y., Du W., Stillman DJ., Roth SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Cells carrying LexA-Ssn6/CYC8 and HA-Rpd3 or HA-Hos2 expression plasmids have been used. Anti-LexA antibodies have been used. The experiment was repeated in the presence of ethidium bromide. syr@mdacc.tm.edu Accepted 2007-AUG-25 by DAVET. Genes Dev. (0890-9369) 2000 davet cyc8_yeast General transcriptional corepressor CYC8 CYC8 CRT8 YBR112C YBR0908 SSN6 Glucose repression mediator protein CYC8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNPGGEQTIMEQPAQQQQQQQQQQQQQQQQAAVPQQPLDPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQLENPGNINKSNGAPTNASPAPPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQQHPAQQTPINSSATMYSNGASPQLQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQAQAQAQAQAQAQAQAQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQPLPRQQLQQKGVSVQMLNPQQGQPYITQPTVIQAHQLQPFSTQAMEHPQSSQLPPQQQQLQSVQHPQQLQGQPQAQAPQPLIQHNVEQNVLPQKRYMEGAIHTLVDAAVSSSTHTENNTKSPRQPTHAIPTQAPATGITNAEPQVKKQKLNSPNSNINKLVNTATSIEENAKSEVSNQSPAVVESNTNNTSQEEKPVKANSIPSVIGAQEPPQEASPAEEATKAASVSPSTKPLNTEPESSSVQPTVSSESSTTKANDQSTAETIELSTATVPAEASPVEDEVRQHSKEENGTTEASAPSTEEAEPAASRDAEKQQDETAATTITVIKPTLETMETVKEEAKMREEEQTSQEKSPQENTLPRENVVRQVEEDENYDD FC2D0D0C1B181207 FC2D0D0C1B181207 hos2_yeast Probable histone deacetylase HOS2 G1330 YGL194C HOS2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGTFSYDVKTKENEPLFEFNSAYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHKIMDLYETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTLYTGASLDATRKLINNQSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHPRILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNGEFFPGTGDLTEIGCDKGKHFALNVPLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGLPMLVVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEDIPFRDSFGPDYSLYPMLDDLYENKNSKKLLEDIRIRCLENIRYLQGAPSVRMDAECIPTQDISALTEEEDKIIQEMNEETEADSSNRLEEMEKENSGLIAFS 024E8AEA0A445A08 rpd3_yeast Histone deacetylase RPD3 RPD3 SDI2 YNL330C N0305 MOF6 REC3 SDS6 Transcriptional regulatory protein RPD3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDYKLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYAPSVQLNHTPRDAEDLGDVEEDSAEAKDTKGGSQYARDLHVEHDNEFY 34FFD72A7E7425DB 34FFD72A7E7425DB tup1_yeast General transcriptional corepressor TUP1 TUP1 AAR1 AER2 AMM1 CYC9 FLK1 SFL2 UMR7 YCR084C YCR84C Glucose repression regulatory protein TUP1 Flocculation suppressor protein Repressor AER2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTASVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIKHLKLGLEQRDHQIASLTVQQQRQQQQQQQVQQHLQQQQQQLAAASASVPVAQQPPATTSATATPAANTTTGSPSAFPVQASRPNLVGSQLPTTTLPVVSSNAQQQLPQQQLQQQQLQQQQPPPQVSVAPLSNTAINGSPTSKETTTLPSVKAPESTLKETEPENNNTSKINDTGSATTATTTTATETEIKPKEEDATPASLHQDHYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDDSAANNHRNSITENNTTTSTDNNTMTTTTTTTITTTAMTSAAELAKDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN 444104AAD63CB944 444104AAD63CB944 rpd3-cyc8-1 4 5 unspecified role unspecified role prey prey region LexA-Ssn6/CYC8 fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A The interaction was independent of treatment with ethidium bromide. hos2-cyc8-1 4 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region LexA-Ssn6/CYC8 fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4 Interaction was independent from treatment with ethidium bromide. cyc8--hos2-1 2 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4B tup1-rpd3-2 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4C tup1-cyc8-1 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4C