IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of chromatin structure by site-specific histone H3 methyltransferases. Regulation of chromatin structure by site-specific histone H3 methyltransferases. Nature (0028-0836) 2000 Rea S., Eisenhaber F., O'Carroll D., Strahl BD., Sun ZW., Schmid M., Opravil S., Mechtler K., Ponting CP., Allis CD., Jenuwein T. Chromatin - Epigenetic interactions resulting in chromatin modulation in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Rea S., Eisenhaber F., O'Carroll D., Strahl BD., Sun ZW., Schmid M., Opravil S., Mechtler K., Ponting CP., Allis CD., Jenuwein T. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 2000 Regulation of chromatin structure by site-specific histone H3 methyltransferases. Regulation of chromatin structure by site-specific histone H3 methyltransferases. Nature (0028-0836) 2000 Rea S., Eisenhaber F., O'Carroll D., Strahl BD., Sun ZW., Schmid M., Opravil S., Mechtler K., Ponting CP., Allis CD., Jenuwein T. Chromatin - Epigenetic interactions resulting in chromatin modulation in vitro In vitro radiolabeled methyl methyltransferase radiometric assay radiolabeled methyl predetermined predetermined participant predetermined Rea S., Eisenhaber F., O'Carroll D., Strahl BD., Sun ZW., Schmid M., Opravil S., Mechtler K., Ponting CP., Allis CD., Jenuwein T. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 2000 h31_bovin Histone H3.1 protein protein bovin Bos taurus (Bovine) Bovine MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 9B89008EA50A0EF6 suv91_mouse Histone-lysine N-methyltransferase SUV39H1 Suv39h1 Suv39h Suppressor of variegation 3-9 homolog 1 Position-effect variegation 3-9 homolog Histone H3-K9 methyltransferase 1 protein protein mouse Mus musculus Mouse MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGVSKKNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDSENTWEPRQNLKCIRVLKQFHKDLERELVRRHRRSKPPRHLDPNLANYLVQKAKQRRALQRWEQELNAKRSHLGRITVENEVDLDGPPRSFVYINEYRVGEGITLNQVAVGCECQDCLLAPTGGCCPGASLHKFAYNDQGQVRLKAGQPIYECNSRCCCGYDCPNRVVQKGIRYDLCIFRTNDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTTACRKYLF DIP protein O54864 original sequence version: 130 DIP protein O54864 original sequence version: 109 6B690F4FE7FD997C ipl1_yeast Spindle assembly checkpoint kinase IPL1 YPL209C Aurora kinase Increase-in-ploidy protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQRNSLVNIKLNANSPSKKTTTRPNTSRINKPWRISHSPQQRNPNSKIPSPVREKLNRLPVNNKKFLDMESSKIPSPIRKATSSKMIHENKKLPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWILRNKPFWENKRL 44E3EFDDE1CDB35E h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P68431 original sequence version: 78 DIP protein P68431 original sequence version: 79 DIP protein P68431 original sequence version: 76 DIP protein P68431 original sequence version: 92 DIP protein P68431 original sequence version: 87 DIP protein P68431 original sequence version: 101 DIP protein P68431 original sequence version: 130 DIP protein P68431 original sequence version: 115 9B89008EA50A0EF6 clr4_schpo Histone-lysine N-methyltransferase, H3 lysine-9 specific clr4 SPBC428.08c kmt1 Histone H3-K9 methyltransferase Cryptic loci regulator 4 Lysine N-methyltransferase 1 Protein lysine methyltransferase clr4 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRELNVKKENKKVFSSQTTKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEESQKRELVSNSIKEATSPKTSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQSQKSQQNRISKLRRQCKCGSANCRGWLFG 53C3EC87BCBA51FF 53C3EC87BCBA51FF suv91_human Histone-lysine N-methyltransferase SUV39H1 SUV39H1 SUV39H KMT1A Suppressor of variegation 3-9 homolog 1 Position-effect variegation 3-9 homolog Histone H3-K9 methyltransferase 1 Lysine N-methyltransferase 1A protein protein human Homo sapiens Human MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF DIP protein O43463 original sequence version: 137 DIP protein O43463 original sequence version: 157 DIP protein O43463 original sequence version: 116 AF6F959AD20C6C76 suv92_mouse Histone-lysine N-methyltransferase SUV39H2 Suv39h2 Suppressor of variegation 3-9 homolog 2 Histone H3-K9 methyltransferase 2 protein protein mouse Mus musculus Mouse MATARAKARGSEAGARCHRAPGPPPRPKARRTARRRRAETLTARRSRPSAGERRAGSQRAWSGAPRAAVFGDECARGALFKAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVAKGVEYYLVKWKGWPDSTNTWEPLRNLRCPQLLRQFSDDKKTYLAQERKCKAVNSKSLQPAIAEYIVQKAKQRIALQRWQDYLNRRKNHKGMIFVENTVDLEGPPLDFYYINEYRPAPGISINSEATFGCSCTDCFFDKCCPAEAGVVLAYNKKQQIKIQPGTPIYECNSRCRCGPECPNRIVQKGTQYSLCIFKTSNGCGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFSVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGEASSDSIDHSPAKKRVRTQCKCGAETCRGYLN DIP protein Q9EQQ0 original sequence version: 119 4008D46CF0F07006 suvar39h1-p16105-1 2 8 enzyme enzyme unspecified role unspecified role human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role methylation methylation reaction methylation SUVAR39H1 was myc-tagged. C terminal region of SUVAR39H1 is necessary for interaction (AA118-412). Revisit when protein Editor in place. H3 is methylated. Reaction observed in the presence of SAM as methyl-group donor. suvar39h1-p16105-2 2 4 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 3 enzyme target enzyme target substrate substrate unspecified role unspecified role methylation methylation reaction methylation Methylation of histone H3. SAM necessary for reaction. Suvar39h1 (AA 82-412) was GST-tagged. C terminal region of Suv39h1 (AA 221-412)is necessary for interaction. Revisit when Protein Editor in place. suvar39h1-p16106-3 2 8 enzyme enzyme unspecified role unspecified role human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role methylation methylation reaction methylation AA 82-412 of SUV39H1 was GST tagged. SAM required for reaction. H3 is methylated. Revisit when Protein Editor in place. clr4-p16106-1 2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) methylation methylation reaction methylation SAM necessary for the reaction. CLR4 GST tagged. Methylation of histone H3. Revisit when Protein Editor in place. suv39h2-p16106-1 2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) methylation methylation reaction methylation SAM necessary for this reaction. Suv39h2 GST tagged. Methylation of histone H3. Revisit when Protein Editor in place. suv39h1-p16106-4 1 4 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) methylation methylation reaction methylation AA 82-412 of Suvar39h1 was GST tagged. AA 1-20 of H3 was chemically synthesized. SAM was necessary as methyl group donor for reaction. Revisit when Protein Editor in place. Peptide. Mehtylation of H3 peptide at K9 position. ipl1-p16106-1 1 5 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation Aurora is His tagged. H3 peptide AA 1-20 phosphorylated at S10. Phosphorylation of H3 peptide at S10. Revisit when Protein Editor in place. Peptide.