IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. J. Biol. Chem. (0021-9258) 2000 imex curation Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu Accepted 2006-APR-20 by KROBBE. Precipitation was carried out with affinity purified anti-rNASP antibodies. J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. J. Biol. Chem. (0021-9258) 2000 imex curation Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu Accepted 2006-APR-20 by KROBBE. J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. J. Biol. Chem. (0021-9258) 2000 imex curation Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu Only protein-protein interactions mouse-myeloma_66_2 Mus musculus myeloma cell line myeloma_66_2 mouse myeloma 66-2 cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu Accepted 2006-APR-20 by KROBBE. J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation h14_mouse Histone H1.4 H1-4 H1 VAR.2 H1e H1f4 Hist1h1e protein protein mouse Mus musculus Mouse MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKRAGAAKAKKPAGAAKKPKKAAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAKKK 9463467F699F3625 h13_mouse Histone H1.3 H1-3 H1 VAR.4 H1d H1f3 Hist1h1d protein protein mouse Mus musculus Mouse MSETAPAAPAAPAPVEKTPVKKKAKKTGAAAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKKATGAATPKKTAKKTPKKAKKPAAAAGAKKVSKSPKKVKAAKPKKAAKSPAKAKAPKAKASKPKASKPKATKAKKAAPRKK 19D888981281E55C h12_mouse Histone H1.2 H1-2 H1 VAR.1 H1c H1f2 Hist1h1c protein protein mouse Mus musculus Mouse MSEAAPAAPAAAPPAEKAPAKKKAAKKPAGVRRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGILVQTKGTGASGSFKLNKKAASGEAKPQAKKAGAAKAKKPAGAAKKPKKATGAATPKKAAKKTPKKAKKPAAAAVTKKVAKSPKKAKVTKPKKVKSASKAVKPKAAKPKVAKAKKVAAKKK DIP protein P15864 original sequence version: 107 2872A9BCD50C840D nasp_mouse Nuclear autoantigenic sperm protein Nasp protein protein mouse Mus musculus Mouse MATESTAAAAIAAELVSADKIEDAPAPSTSADKMESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNVDEEAREELREQVYDAMGEKEAKKAEGKSLTKPETDKEQESEVEKGGREDMDISEPEEKLQETVEPTSKQLTESSEEAKEAAIPGLNEDEVASGKTEQESLCTEKGKSISGAYVQNKEFRETVEEGEEIISLEKKPKETSEDQPIRAAEKQGTLMKVVEIEAEIDPQVKSADVGGEEPKDQVATSESELGKAVLMELSGQDVEASPVVAAEAGAEVSEKPGQEITVIPNNGPVVGQSTVGDQTPSEPQTSAERLTETKDGSSVEEVKAELVPEQEEAMLPVEESEAAGDGVETKVAQKATEKAPEDKFKIAANEETPERDEQMKEGEETEGSEEEDRENDKAEETPNESVLEKKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESENYIQAVEEFQACLSLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFGKSIDVIEKRMAVLHEQMKEAEGSFTEYEKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLVESSTSGFTPSGAGASVSMIASRKPTDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVSSGKEVSENMEAEAENQAESQTAEGTVESAATIKSTAC 63C5CCA025972390 h15_mouse Histone H1.5 H1-5 H1 VAR.5 H1b H1f5 Hist1h1b protein protein mouse Mus musculus Mouse MSETAPAETAAPAPVEKSPAKKKTTKKAGAAKRKATGPPVSELITKAVSASKERGGVSLPALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKTGAAKAKKPAGATPKKPKKTAGAKKTVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKAAKSPAKPKAVKSKASKPKVTKPKTAKPKAAKAKKAVSKKK B9C26AC31C2716B6 nasp-hist1h1b 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association nasp-hist1h1c-1 2 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait biotin fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction nasp-hist1h1c-2 1 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction