IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers. Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers. J. Biol. Chem. (0021-9258) 1998 imex curation Corey S., Clapham D.E. Cardiac - Interactions involving cardiac related proteins clapham@rascal.med.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Corey S., Clapham D.E. Cardiac - Interactions involving cardiac related proteins clapham@rascal.med.harvard.edu Accepted 2014-NOV-26 by ORCHARD J. Biol. Chem. (0021-9258) 1998 imex curation Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers. Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers. J. Biol. Chem. (0021-9258) 1998 imex curation Corey S., Clapham D.E. Cardiac - Interactions involving cardiac related proteins clapham@rascal.med.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Corey S., Clapham D.E. Cardiac - Interactions involving cardiac related proteins clapham@rascal.med.harvard.edu Accepted 2014-NOV-26 by ORCHARD J. Biol. Chem. (0021-9258) 1998 imex curation Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers. Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers. J. Biol. Chem. (0021-9258) 1998 imex curation Corey S., Clapham D.E. Cardiac - Interactions involving cardiac related proteins clapham@rascal.med.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Corey S., Clapham D.E. Cardiac - Interactions involving cardiac related proteins clapham@rascal.med.harvard.edu Accepted 2014-NOV-26 by ORCHARD J. Biol. Chem. (0021-9258) 1998 imex curation kcnj5_rat G protein-activated inward rectifier potassium channel 4 Kcnj5 Girk4 Cardiac inward rectifier Heart KATP channel Inward rectifier K(+) channel Kir3.4 KATP-1 Potassium channel, inwardly rectifying subfamily J member 5 protein protein rat Rattus norvegicus (Rat) Rat MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLPEGKKPRQRYMEKTGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYVRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKRNGQLLQSLPSPPLLGGCAEAEKEAEAEHDEEEEPNGLSVSRATRGSM DFF537CD79A7370D kcnj5_bovin G protein-activated inward rectifier potassium channel 4 Cardiac inward rectifier GIRK4 Heart KATP channel Inward rectifier K(+) channel Kir3.4 KATP-1 Potassium channel, inwardly rectifying subfamily J member 5 KCNJ5 protein protein bovin Bos taurus (Bovine) Bovine MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLSEGKKPRQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYIRGDLDHVGDREWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIVLLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISLRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIICHEINEKSPFWEMSRAQLTQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYHPSPPLPGGCVGAELGAEAEQEGEEEPEGLSGSQETKDSA 75B254761DD3C0B8 kcnj3_bovin G protein-activated inward rectifier potassium channel 1 GIRK1 Inward rectifier K(+) channel Kir3.1 Potassium channel, inwardly rectifying subfamily J member 3 KCNJ3 protein protein bovin Bos taurus (Bovine) Bovine MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQSEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGATRMEGNLPAKLRKMNSDRFT E388B6FF8187CABE kcnj5-kcnj5 1 4 unspecified role unspecified role bait bait c-terminus au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 5 I am not cloning this interaction to a biological complex (homotetramer), as people believe that inside the celsl the K+ channels consist of heteromultimers only. kcnj5-kcnj3-2 2 6 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 5 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physical association physical association Fig. 2, 3 kcnj5-kcnj3-3 3 5 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep 6 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physical association physical association Fig. 7 kcnj5-1 3 5 unspecified role unspecified role bait bait physical association physical association Fig.7 I am not cloning this interaction to a biological complex (homotetramer), as people believe that inside the celsl the K+ channels consist of heteromultimers only.