IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. The Journal of cell biology 2014 imex curation Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Cardiac - Interactions involving cardiac related proteins Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs predetermined predetermined participant predetermined Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Accepted 2015-MAY-08 by ORCHARD The Journal of cell biology 2014 Only protein-protein interactions imex curation imex curation Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. The Journal of cell biology 2014 imex curation Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Cardiac - Interactions involving cardiac related proteins Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Only protein-protein interactions imex curation human-keratinocyte Homo sapiens keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Normal Human Epidermal Keratinocytes Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Accepted 2015-MAY-08 by ORCHARD The Journal of cell biology 2014 Only protein-protein interactions imex curation imex curation Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. The Journal of cell biology 2014 imex curation Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Cardiac - Interactions involving cardiac related proteins Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Accepted 2015-MAY-08 by ORCHARD The Journal of cell biology 2014 Only protein-protein interactions imex curation imex curation Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. The Journal of cell biology 2014 imex curation Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Cardiac - Interactions involving cardiac related proteins Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Only protein-protein interactions imex curation human-scc9 Homo sapiens scc9 Oral squamous carcinoma (tongue) SCC-9 cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Normal Human Epidermal Keratinocytes Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Accepted 2015-MAY-08 by ORCHARD The Journal of cell biology 2014 Only protein-protein interactions imex curation imex curation Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. The Journal of cell biology 2014 imex curation Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Cardiac - Interactions involving cardiac related proteins Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. the stratgene manual says that:-"To identify the protein encoded by the target DNA, the nucleotide sequence of the target DNA can be determined and compared to protein and nucleotide sequence databases to identify related or homologous proteins." So I assume this means they sequenced the preys.. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Accepted 2015-MAY-08 by ORCHARD HeLa cell cDNAs The Journal of cell biology 2014 Only protein-protein interactions imex curation imex curation Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions. The Journal of cell biology 2014 imex curation Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Cardiac - Interactions involving cardiac related proteins Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Only protein-protein interactions imex curation human-scc9 Homo sapiens scc9 Oral squamous carcinoma (tongue) SCC-9 cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Patel DM., Dubash AD., Kreitzer G., Green KJ. Affinomics - Interactions curated for the Affinomics consortium. Results from figures 4D and Supplementary figure 3C have not been included as the origins of the constructs used is not stated, and for the plakoglobin (Pg-Myc) construct the cell line used is also unclear. Normal Human Epidermal Keratinocytes Species of origin of Desmoplakin inferred from previous work of the author. kgreen@northwestern.edu Accepted 2015-MAY-08 by ORCHARD The Journal of cell biology 2014 Only protein-protein interactions imex curation imex curation pkp2_human Plakophilin-2 PKP2 protein protein human Homo sapiens Human MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQTVKSLRIQEQVQQTLARKGRSSVGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRYARSEIVGVSRAGTTSRQRHFDTYHRQYQHGSVSDTVFDSIPANPALLTYPRPGTSRSMGNLLEKENYLTAGLTVGQVRPLVPLQPVTQNRASRSSWHQSSFHSTRTLREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADMEMTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALRNLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITDHTVNLRSRNGWPGAVAHACNPSTLGGQGGRITRSGVRDQPDQHGLLWNLSSNDKLKNLMITEALLTLTENIIIPFSGWPEGDYPKANGLLDFDIFYNVTGCLRNMSSAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKYSQNIYIQNRNIQTDNNKSIGCFGSRSRKVKEQYQDVPMPEEKSNPKGVEWLWHSIVIRMYLSLIAKSVRNYTQEASLGALQNLTAGSGPMPTSVAQTVVQKESGLQHTRKMLHVGDPSVKKTAISLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNIIQNSYQNARDLLNTGGIQKIMAISAGDAYASNKASKAASVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD DIP protein Q99959 original sequence version: null 947838B0C8275D5D plak_human Junction plakoglobin JUP DP3 CTNNG Desmoplakin-3 Desmoplakin III Catenin gamma protein protein human Homo sapiens Human MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA DIP protein P14923 original sequence version: 159 3519A0973748BCF4 mare1_human Microtubule-associated protein RP/EB family member 1 APC-binding protein EB1 End-binding protein 1 MAPRE1 protein protein human Homo sapiens Human MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY DIP protein Q15691 original sequence version: 154 DIP protein Q15691 original sequence version: 151 DIP protein Q15691 original sequence version: 143 DIP protein Q15691 original sequence version: 84 08C8999F45A145ED p15924-2 Desmoplakin DSP 250/210 kDa paraneoplastic pemphigus antigen DP2 protein protein human Homo sapiens Human MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHSQTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKDYELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKASNRIQESKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLISPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSSMGSGVSDDVFSSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH 84F0CD39B48E1339 desp_human Desmoplakin DSP 250/210 kDa paraneoplastic pemphigus antigen protein protein human Homo sapiens Human MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHSQTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKDYELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSEEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEVSQRKQQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCLEDENARLQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQNSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLEQASIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDKNATILELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLISPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSSMGSGVSDDVFSSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH DIP protein P15924 original sequence version: 137 5770CC6B4F9F9F7B dsp-mapre1-1 5 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association no figure dsp-jup-1 5 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association no figure-2 positive control dsp-jup-2 1 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association 1 the stratgene manual says that:-"To identify the protein encoded by the target DNA, the nucleotide sequence of the target DNA can be determined and compared to protein and nucleotide sequence databases to identify related or homologous proteins." So I assume this means they sequenced the preys.. dsp-mapre1-2 1 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association 1 dsp-mapre1-3 3 11 unspecified role unspecified role prey prey c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role bait bait n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 1C dsp-mapre1-8 2 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1D dsp-mapre1-4 6 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2C dsp-mapre1-5 4 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 2C dsp-mapre1-6 6 10 unspecified role unspecified role neutral component neutral component c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P15924-2:p.Ile533Thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I T Wed May 02 19:40:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile533thr' Tue Jun 30 16:51:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile533Thr' P15924-2:p.Asn458Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N Y Wed May 02 14:45:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn458tyr' Tue Jun 30 18:04:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn458Tyr' 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A mapre1-dsp-2 3 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey human-keratinocyte Homo sapiens keratinocyte Keratinocyte physical association physical association Supp 1A It is stated that EB1 associated weakly with DP 1–179 and more so with 1–630, binding was most robust in the presence of all N-terminal SRs. dsp-mapre1-7 6 7 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 1B dsp-pkp2-1 4 7 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component physical association physical association Supp 1B