IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Super-resolution fluorescence microscopy of the cardiac connexome reveals plakophilin-2 inside the connexin43 plaque. Super-resolution fluorescence microscopy of the cardiac connexome reveals plakophilin-2 inside the connexin43 plaque. Cardiovasc. Res. (0008-6363) 2013 imex curation Agullo-Pascual E., Reid D.A., Keegan S., Sidhu M., Fenyö D., Rothenberg E., Delmar M. Cardiac - Interactions involving cardiac related proteins Affinomics - Interactions curated for the Affinomics consortium. mario.delmar@nyumc.org,eli.rothenbreg@nyumc.org,david@fenyolab.org 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-cardiac_myocytes_neo rat cardiac myocytes neo neonatal_ventricular_myocyte neonatal ventricular myocyte fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Agullo-Pascual E., Reid D.A., Keegan S., Sidhu M., Fenyö D., Rothenberg E., Delmar M. Cardiac - Interactions involving cardiac related proteins SRFM -Super-resolution fluorescence microscopy. Neonatal rat ventricular myocytes mario.delmar@nyumc.org,eli.rothenbreg@nyumc.org,david@fenyolab.org Accepted 2014-SEP-24 by ORCHARD Cardiovasc. Res. (0008-6363) 2013 Only protein-protein interactions imex curation Super-resolution fluorescence microscopy of the cardiac connexome reveals plakophilin-2 inside the connexin43 plaque. Super-resolution fluorescence microscopy of the cardiac connexome reveals plakophilin-2 inside the connexin43 plaque. Cardiovasc. Res. (0008-6363) 2013 imex curation Agullo-Pascual E., Reid D.A., Keegan S., Sidhu M., Fenyö D., Rothenberg E., Delmar M. Cardiac - Interactions involving cardiac related proteins Affinomics - Interactions curated for the Affinomics consortium. mario.delmar@nyumc.org,eli.rothenbreg@nyumc.org,david@fenyolab.org 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Agullo-Pascual E., Reid D.A., Keegan S., Sidhu M., Fenyö D., Rothenberg E., Delmar M. Cardiac - Interactions involving cardiac related proteins adult mouse cardiac ventricle tissue mario.delmar@nyumc.org,eli.rothenbreg@nyumc.org,david@fenyolab.org Accepted 2014-SEP-24 by ORCHARD Cardiovasc. Res. (0008-6363) 2013 Only protein-protein interactions imex curation Super-resolution fluorescence microscopy of the cardiac connexome reveals plakophilin-2 inside the connexin43 plaque. Super-resolution fluorescence microscopy of the cardiac connexome reveals plakophilin-2 inside the connexin43 plaque. Cardiovasc. Res. (0008-6363) 2013 imex curation Agullo-Pascual E., Reid D.A., Keegan S., Sidhu M., Fenyö D., Rothenberg E., Delmar M. Cardiac - Interactions involving cardiac related proteins Affinomics - Interactions curated for the Affinomics consortium. mario.delmar@nyumc.org,eli.rothenbreg@nyumc.org,david@fenyolab.org 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Agullo-Pascual E., Reid D.A., Keegan S., Sidhu M., Fenyö D., Rothenberg E., Delmar M. Cardiac - Interactions involving cardiac related proteins I have left co-loc GO term in, same as for other expt - but nothing is specifically said - so maybe this GO term should be removed? mario.delmar@nyumc.org,eli.rothenbreg@nyumc.org,david@fenyolab.org Accepted 2014-SEP-24 by ORCHARD Cardiovasc. Res. (0008-6363) 2013 Only protein-protein interactions imex curation q562c0_rat Pkp2 protein protein rat Rattus norvegicus (Rat) Rat PEGDYPKANGLLDFDIFYNVTGCLRNMSSAGPDGRKVMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKYSQSIYMQNRNIQTNSNKSIGCFGSRSRKVKEQYQDTPMPEERSSPRGIEWLWHSIVIRMYLSLIAKSSRNYTQEASLGALQNLTAGSGPIPTSVARMVVQKENGLQHTRKMLHVGDPSVKKTAVSLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNLMQNSYQNARDLLNTGGLQKIMTISIGEGYAPNKASKAASVLLYSLWAHTELHNAYKKAQFKKTDFVNSRTAKASHSLKD 690F39DFBCA0AEDD q9cq73_mouse Pkp2 protein protein mouse Mus musculus Mouse MAVPGSLAECGYIRTVLGQQILGHLDSSSLALPSEARLRLAGSSGRGDPAARSQRIQEQVQQTLARRGRSSAVSGNLHRTSSVPEYVYKLHVVENDFVGRQSPVTRDYDMLKAGMTATYGSRWGRAAAQYSSQKSVEERSWRQPLRRLEISPDSSPERAHYGHSEYQYAWRSHVVPGGRLTLPRYARSEILGLRQAGTARRPPGCGSFSDAVFDNGPLKPTMPTHPPGTSHSAGSLLEETTVRVSQARLQSTQSRTARSSWPRSSVRSSLREPGRMLTTAGQAAVGSGDAHGDRSVFADAQLGNADIEMTLERAVNMLDADHVPVSKISAAATFIQHESFQKSEARKRVNQLRGIPKLLQLLKLQNEDVQRAACGALRNLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITGLLWNLSSSDKLKHLMITEALLTLTESVIIPFSGWPEGDYPKANGLLDFDIFYNVTGCLRNMSSAGPDGRKMMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKYSQSIYMQNRNIQTNSNKSIGCFGSRSRKLKEQYQDLQMPEERSNPHGIEWLWHSIVIRMYLSLIAKSTRNYTQEASLGALQNLTAGGGPIPTLVARMVVQKENGLQHTRKMLHVGDPSVKKTAVSLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNLMQNSYQNARDLLNTGGLQKIMTISIGEGYAPNKASKAASVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD mint BBA0B87301C4C822 cxa1_mouse Gap junction alpha-1 protein Gja1 Cxn-43 Connexin-43 Gap junction 43 kDa heart protein protein protein mouse Mus musculus Mouse MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI DIP protein P23242 original sequence version: 72 DIP protein P23242 original sequence version: 132 DIP protein P23242 original sequence version: 153 018DCB461FA69490 cxa1_rat Gap junction alpha-1 protein Gja1 Cxn-43 Connexin-43 Gap junction 43 kDa heart protein protein protein rat Rattus norvegicus (Rat) Rat MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI DIP protein P08050 original sequence version: 110 DIP protein P08050 original sequence version: 147 0196416EA6A69490 gja1-pkp2 1 4 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 1,2,3,4 The size of the Cx43-PKP2 co-localization area was significantly affected by the absence of AnkG. In cells lacking AnkG expression the area of co-localization with PKP2 varied over a wider range than controls, allowing the formation of larger sized plaques. gja1-pkp2-1 3 7 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6A The size of the Cx43-PKP2 co-localization area was significantly affected by the absence of AnkG. In cells lacking AnkG expression the area of co-localization with PKP2 a varied over a wider range than controls, allowing the formation of larger sized plaques. gja1-pkp2-2 2 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6 I think they have got their image/legend labels wrong - rather than write a caution I have just labeled this "Fig 6" - (should be Fig 6B though text says 6C.) They also refer to a Fig 6D - I cannot see this at all.