IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC cell biology 2010 imex curation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins hm@sun.ac.za Accepted 2015-MAY-07 by ORCHARD BMC cell biology 2010 imex curation Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC cell biology 2010 imex curation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Only protein-protein interactions imex curation rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Accepted 2015-MAY-08 by ORCHARD BMC cell biology 2010 imex curation Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC cell biology 2010 imex curation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins A '26S proteasome subunit' was also identified as an interactor with MMGL isoform 4 Bait, but the exact protein found is not stated. Dear Checker; For Bait Mybpc3 please make sure the S to E mutation numbers are correctly entered - most references only describe mouse mutations which have different numbering. Table1: two identifiers are stated for every protein; the "genomic" one (LHS column) would appear to be the "correct" ID - whereas the "in-frame ORF/protein HIT" column refers to (?) - not all IDs refer to same protein as in other column... hm@sun.ac.za Accepted 2015-MAY-07 by ORCHARD human MATCHMAKER™ cardiac cDNA library BMC cell biology 2010 imex curation Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC cell biology 2010 imex curation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Accepted 2015-MAY-08 by ORCHARD BMC cell biology 2010 imex curation Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC cell biology 2010 imex curation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Only protein-protein interactions imex curation rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Accepted 2015-MAY-20 by ORCHARD BMC cell biology 2010 Only protein-protein interactions imex curation imex curation done; done Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC cell biology 2010 imex curation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Only protein-protein interactions imex curation rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Accepted 2015-MAY-20 by ORCHARD BMC cell biology 2010 imex curation Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC cell biology 2010 imex curation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Only protein-protein interactions imex curation rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts fluorescence imaging fluorescence microscopy fluorescence imaging tag visualisation tag visualisation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins I have left the XRef as "cytosol" for Figure 4 images - but this is not stated anywhere- however coloc is obviously NOT nuclear. (if you dont like this either send it back or remove!) The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za Accepted 2015-MAY-08 by ORCHARD BMC cell biology 2010 imex curation flnc_human Filamin-C Filamin-2 Actin-binding-like protein ABP-L ABP-280-like protein Gamma-filamin FLNC ABPL FLN2 protein protein human Homo sapiens Human MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDLQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPHEEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP DIP protein Q14315 original sequence version: null B7C8516C2366E75D tcph_human T-complex protein 1 subunit eta CCT7 CCTH NIP7-1 CCT-eta HIV-1 Nef-interacting protein protein protein human Homo sapiens Human MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH DIP protein Q99832 original sequence version: 112 9F1E33FA80E6238E mypc3_human Myosin-binding protein C, cardiac-type C-protein, cardiac muscle isoform MYBPC3 protein protein human Homo sapiens Human MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ DIP protein Q14896 original sequence version: null 4E5385C40085B796 kap0_rat cAMP-dependent protein kinase type I-alpha regulatory subunit Prkar1a protein protein rat Rattus norvegicus (Rat) Rat MASGSMAASEEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV AF00CA8DECE462FC cox5a_human Cytochrome c oxidase subunit 5A, mitochondrial Cytochrome c oxidase polypeptide Va COX5A protein protein human Homo sapiens Human MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV 104DAF468BD302FC snx3_human Sorting nexin-3 Protein SDP3 SNX3 protein protein human Homo sapiens Human MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA 983D422FCA6E07BC ankr1_human Ankyrin repeat domain-containing protein 1 C193 CARP Cardiac ankyrin repeat protein Cytokine-inducible gene C-193 protein Cytokine-inducible nuclear protein HA1A2 ANKRD1 protein protein human Homo sapiens Human MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF 9AD91D2B1344A235 enob_human Beta-enolase ENO3 2-phospho-D-glycerate hydro-lyase Enolase 3 Muscle-specific enolase Skeletal muscle enolase protein protein human Homo sapiens Human MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAIFAGRKFRNPKAK DIP protein P13929 original sequence version: null 4D9D8DCF32CF153F actc_human Actin, alpha cardiac muscle 1 ACTC1 ACTC Alpha-cardiac actin protein protein human Homo sapiens Human MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF DIP protein P68032 original sequence version: null E5C10FA19730CAD2 enob_rat Beta-enolase 2-phospho-D-glycerate hydro-lyase Enolase 3 Muscle-specific enolase Skeletal muscle enolase Eno3 Eno-3 protein protein rat Rattus norvegicus (Rat) Rat MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLKAVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVDIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAVFAGRKFRNPKAK 136A5300E052D5A7 kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ DIP protein P13861 original sequence version: 107 DIP protein P13861 original sequence version: 128 C7D6E8E476E1DB65 ankr1_rat Ankyrin repeat domain-containing protein 1 Cardiac adriamycin-responsive protein Cardiac ankyrin repeat protein Ankrd1 Carp protein protein rat Rattus norvegicus (Rat) Rat MMVFRVEELVTGKKNSNGSSGEFLPGEFRNGEYEAAVALEKQEDLKTLPANSVNLGEEQRKSEKVREAELKKKKLEQRSKLENLEDLEIIVQLKKRKKYKKTKVPVVKEPEPEIITEPVDVPRFLKAALENKLPVVEKFLSDKNSPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWACRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTFGADLNVKNCAGKTPMDLVLHWQNGTKAIFDSLKENAYKNSRIATF E760BF7BFD6049E0 spt20_human Spermatogenesis-associated protein 20 Sperm-specific protein 411 SPATA20 protein protein human Homo sapiens Human MLGARAWLGRVLLLPRAGAGLAASRRGSSSRDKDRSATVSSSVPMPAGGKGSHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYSQAFQLSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTLLNSGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRLQDTQDKLFWDSQGGGYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALVQCVHSVYIPNKVLILADGDPSSFLSRQLPFLSTLRRLEDQATAYVCENQACSVPITDPCELRKLLHP 00C3CCE7C7BD8438 enoa_rat Alpha-enolase 2-phospho-D-glycerate hydro-lyase Non-neural enolase Enolase 1 Eno1 Eno-1 protein protein rat Rattus norvegicus (Rat) Rat MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKSAIAKAGYTDQVVIGMDVAASEFYRAGKYDLDFKSPDDASRYITPDQLADLYKSFIKDYPVVSIEDPFDQDDWDAWQKFTATAGIQVVGDDLTVTNPKRIAKAAGEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK 736660B2D5E936DC tnni3_rat Troponin I, cardiac muscle Cardiac troponin I Tnni3 Ctni Tni protein protein rat Rattus norvegicus (Rat) Rat MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRGEKGRVLSTRCQPLVLDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG 17586B0FDB682B4C cnn1_human Calponin-1 CNN1 Basic calponin Calponin H1, smooth muscle protein protein human Homo sapiens Human MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA A949573543BC246C comd4_human COMM domain-containing protein 4 COMMD4 protein protein human Homo sapiens Human MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 7B7B85234E3FB59B kap2_rat cAMP-dependent protein kinase type II-alpha regulatory subunit Prkar2a protein protein rat Rattus norvegicus (Rat) Rat MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDGESESDSDDEDLEVPIPSKFTRRVSVCAETFNPDEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSDGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSKTKTNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNLDLLDPGQ 0D711A1CFEAFB79D enoa_human Alpha-enolase ENO1 ENO1L1 MBPB1 MPB1 2-phospho-D-glycerate hydro-lyase Non-neural enolase Enolase 1 Phosphopyruvate hydratase C-myc promoter-binding protein MBP-1 MPB-1 Plasminogen-binding protein protein protein human Homo sapiens Human MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK DIP protein P06733 original sequence version: null A0ED663FCC15ADA5 myzap_human Myocardial zonula adherens protein MYZAP GRINL1A upstream protein MYOZAP protein protein human Homo sapiens Human MLRSTSTVTLLSGGAARTPGAPSRRANVCRLRLTVPPESPVPEQCEKKIERKEQLLDLSNGEPTRKLPQGVVYGVVRRSDQNQQKEMVVYGWSTSQLKEEMNYIKDVRATLEKVRKRMYGDYDEMRQKIRQLTQELSVSHAQQEYLENHIQTQSSALDRFNAMNSALASDSIGLQKTLVDVTLENSNIKDQIRNLQQTYEASMDKLREKQRQLEVAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEKEALLEETNSFLKAIEEANKKMQAAEISLEEKDQRIGELDRLIERMEKERHQLQLQLLEHETEMSGELTDSDKERYQQLEEASASLRERIRHLDDMVHCQQKKVKQMVEEIESLKKKLQQKQLLILQLLEKISFLEGENNELQSRLDYLTETQAKTEVETREIGVGCDLLPSQTGRTREIVMPSRNYTPYTRVLELTMKKTLT mint homomint 2A6B9C464B8641B4 kap0_human cAMP-dependent protein kinase type I-alpha regulatory subunit Tissue-specific extinguisher 1 PRKAR1A PKR1 PRKAR1 TSE1 protein protein human Homo sapiens Human MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV DIP protein P10644 original sequence version: 173 DIP protein P10644 original sequence version: 127 DIP protein P10644 original sequence version: 134 DIP protein P10644 original sequence version: 179 2D04F08CE8857A6D pard3_human Partitioning defective 3 homolog PARD3 PAR3 PAR3A Atypical PKC isotype-specific-interacting protein CTCL tumor antigen se2-5 PAR3-alpha protein protein human Homo sapiens Human MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYSSYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS DIP protein Q8TEW0 original sequence version: 130 DIP protein Q8TEW0 original sequence version: 137 DIP protein Q8TEW0 original sequence version: 142 DIP protein Q8TEW0 original sequence version: 110 A4FD3F4F9AD8B92A tnni3_human Troponin I, cardiac muscle Cardiac troponin I TNNI3 TNNC1 protein protein human Homo sapiens Human MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES DIP protein P19429 original sequence version: 120 20A804F8C24AE1B0 actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 q5vu43-11 Myomegalin Cardiomyopathy-associated protein 2 Phosphodiesterase 4D-interacting protein PDE4DIP CMYA2 KIAA0454 KIAA0477 MMGL protein protein human Homo sapiens Human MSNGYRTLSQHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDK EF8C9A64D2F3F758 svil_human Supervillin Archvillin p205/p250 SVIL protein protein human Homo sapiens Human MKRKERIARRLEGIENDTQPILLQSCTGLVTHRLLEEDTPRYMRASDPASPHIGRSNEEEETSDSSLEKQTRSKYCTETSGVHGDSPYGSGTMDTHSLESKAERIARYKAERRRQLAEKYGLTLDPEADSEYLSRYTKSRKEPDAVEKRGGKSDKQEESSRDASSLYPGTETMGLRTCAGESKDYALHVGDGSSDPEVLLNIENQRRGQELSATRQAHDLSPAAESSSTFSFSGRDSSFTEVPRSPKHAHSSSLQQAASRSPSFGDPQLSPEARPSTGKPKHEWFLQKDSEGDTPSLINWPSRVKVREKLVKEESARNSPELASESVTQRRHQPAPVHYVSFQSEHSAFDRVPSKAAGSTRQPIRGYVQPADTGHTAKLVTPETPENASECSWVASATQNVPKPPSLTVLEGDGRDSPVLHVCESKAEEEEGEGEGEEKEEDVCFTEALEQSKKTLLALEGDGLVRSPEDPSRNEDFGKPAVSTVTLEHQKELENVAQPPQAPHQPTERTGRSEMVLYIQSEPVSQDAKPTGHNREASKKRKVRTRSLSDFTGPPQLQALKYKDPASRRELELPSSKTEGPYGEISMLDTKVSVAQLRSAFLASANACRRPELKSRVERSAEGPGLPTGVERERGSRKPRRYFSPGESRKTSERFRTQPITSAERKESDRCTSHSETPTVDDEEKVDERAKLSVAAKRLLFREMEKSFDEQNVPKRRSRNTAVEQRLRRLQDRSLTQPITTEEVVIAATEPIPASCSGGTHPVMARLPSPTVARSAVQPARLQASAHQKALAKDQTNEGKELAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRIDTRQRRMNARYQTQPVTLGEVEQVQSGKLIPFSPAVNTSVSTVASTVAPMYAGDLRTKPPLDHNASATDYKFSSSIENSDSPVRSILKSQAWQPLVEGSENKGMLREYGETESKRALTGRDSGMEKYGSFEEAEASYPILNRAREGDSHKESKYAVPRRGSLERANPPITHLGDEPKEFSMAKMNAQGNLDLRDRLPFEEKVEVENVMKRKFSLRAAEFGEPTSEQTGTAAGKTIAQTTAPVSWKPQDSSEQPQEKLCKNPCAMFAAGEIKTPTGEGLLDSPSKTMSIKERLALLKKSGEEDWRNRLSRRQEGGKAPASSLHTQEAGRSLIKKRVTESRESQMTIEERKQLITVREEAWKTRGRGAANDSTQFTVAGRMVKKGLASPTAITPVASPICGKTRGTTPVSKPLEDIEARPDMQLESDLKLDRLETFLRRLNNKVGGMHETVLTVTGKSVKEVMKPDDDETFAKFYRSVDYNMPRSPVEMDEDFDVIFDPYAPKLTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNSNNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQTIEEGINTHTHAAKDFWKLLGGQTSYQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALGRRDRKAYDCMLQDPGSFNFAPRLFILSSSSGDFAATEFVYPARAPSVVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCKGKNLKKPAPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 6C4793D31FCBDF7C mybpc3-pde4dip-1 3 10 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Wed May 02 17:30:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 20:14:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' 32 unspecified role unspecified role prey prey physical association physical association Table1 mybpc3-pde4dip-2 3 10 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 10:59:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 16:53:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 18:21:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' 16 unspecified role unspecified role prey prey physical association physical association Table1-2 mybpc3-actc1-1 3 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 10:59:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 19:41:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 19:36:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range 31 unspecified role unspecified role prey prey physical association physical association Table1-3 mybpc3-actb-1 3 27 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 11:02:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 18:54:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 20:22:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Table1-4 mybpc3-myzap-1 3 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 11:10:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 15:29:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 20:25:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range 8 unspecified role unspecified role prey prey physical association physical association Table1-5 mybpc3-flnc-1 3 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 11:04:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 16:02:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 16:43:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range 23 unspecified role unspecified role prey prey physical association physical association Table1-6 mybpc3-pard3-1 3 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 11:06:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 19:45:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 15:59:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range 29 unspecified role unspecified role prey prey physical association physical association Table1-8 mybpc3-cct7-1 3 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 10:55:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 14:51:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 20:00:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range 9 unspecified role unspecified role prey prey physical association physical association Table1-9 mybpc3-cct7-2 3 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 10:50:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 17:46:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 19:47:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range 33 unspecified role unspecified role prey prey physical association physical association Table1-10 mybpc3-svil-1 3 10 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Fri Jul 22 11:00:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 20:20:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275glu,ser284glu,ser304glu' Tue Jun 30 16:31:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser275Glu;Ser284Glu;Ser304Glu]' c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range 20 unspecified role unspecified role prey prey physical association physical association Table1-11 mybpc3-pde4dip-3 7 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 1 isoproterenol -an beta-adrenergic agonist It has been assumed the non-mutated form of cMyBPC was used here, as Isoproterenol was added to stimulate phosphorylation of the MyBPC-motif, which would not be possible if the serine residues were not present. mybpc3-pde4dip-4 4 32 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 10 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Figure 2A MMGL interacts with the native as well as the trisphospho-mimic form of cMyBPC. mybpc3-pde4dip-5 2 32 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 2B pde4dip-mybpc3-1 2 32 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 2B mybpc3-pde4dip-6 1 18 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Figure 3A pde4dip-prkar1a-1 1 28 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Figure 3A pde4dip-tnni3-1 1 32 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association Figure 3A Positive control mybpc3-pde4dip-7 7 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 3B pde4dip-prkar2a-1 7 28 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 3Bi pde4dip-prkar1a-4 6 11 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3C pde4dip-prkar1a-2 6 32 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 25 unspecified role unspecified role prey prey physical association physical association Figure 3Ci pde4dip-prkar1a-3 5 11 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3C pde4dip-prkar2a-2 5 32 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 25 unspecified role unspecified role bait bait physical association physical association Figure 3Ci mybpc3-pde4dip-9 3 32 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Text near to Table2 pde4dip-snx3-1 3 13 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Text near to Table2 i pde4dip-snx3-2 3 30 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Table 2 pde4dip-tnni3-2 3 14 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Table 2-2 pde4dip-ankrd1-1 3 24 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Table 2-3 pde4dip-commd4-1 3 26 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Table 2-4 pde4dip-eno1-1 3 15 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait physical association physical association Table 2-5 pde4dip-prkar2a-3 7 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 4 ankrd1-pde4dip-1 7 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 24 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 4-1 commd4-pde4dip-1 7 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 26 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 4-2 eno1-pde4dip-1 7 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 4-3 mybpc3-pde4dip-10 7 32 unspecified role unspecified role neutral component neutral component n_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 30 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 5A pde4dip-tnni3-3 7 30 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 32 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 5B isoproterenol -an beta-adrenergic agonist ankrd1-pde4dip-2 5 32 unspecified role unspecified role prey prey n_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 19 unspecified role unspecified role bait bait physical association physical association Figure 6i-A ankrd1-pde4dip-3 6 32 unspecified role unspecified role bait bait n_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 19 unspecified role unspecified role prey prey physical association physical association Figure 6i-B eno1-pde4dip-2 5 32 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role bait bait physical association physical association Figure 6ii-A eno1-pde4dip-3 6 32 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role prey prey physical association physical association Figure 6ii-B eno3-pde4dip-2 5 32 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 17 unspecified role unspecified role bait bait physical association physical association Figure 6iii-A eno3-pde4dip-1 6 32 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 17 unspecified role unspecified role prey prey physical association physical association Figure 6iii-B eno3-pde4dip-3 5 32 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role bait bait physical association physical association Figure 6iv-A tnni3-pde4dip-1 6 32 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role prey prey physical association physical association Figure 6iv-B pde4dip-tnni3-4 2 32 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 24 unspecified role unspecified role prey prey n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 6v-B pde4dip-commd4-2 2 32 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 24 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 6v-A