IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ubiquitin-independent proteasomal degradation of endoplasmic reticulum-localized connexin43 mediated by CIP75. Ubiquitin-independent proteasomal degradation of endoplasmic reticulum-localized connexin43 mediated by CIP75. The Journal of biological chemistry 2010 imex curation Su V., Nakagawa R., Koval M., Lau AF. Cardiac - Interactions involving cardiac related proteins Co-localizations reported in fugures 2B and 7 were not added since Cip75(Ubin) was determined to be of Murine origin from Reference 52. Cx43HKKSL is of Rattine origin - as from reference 53. aflau@crch.hawaii.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su V., Nakagawa R., Koval M., Lau AF. Cardiac - Interactions involving cardiac related proteins Co-localizations reported in fugures 2B and 7 were not added since Cip75(Ubin) was determined to be of Murine origin from Reference 52. Cx43HKKSL is of Rattine origin - as from reference 53. aflau@crch.hawaii.edu Accepted 2015-AUG-17 by PPORRAS The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation I have removed the Data=proc statement from Expt-3, but have left in this experiment as it is the same protein, albeit a different species - so I am no sure if this means we should annotate or not...if you really do not want this, you could delete! cxa1_rat Gap junction alpha-1 protein Gja1 Cxn-43 Connexin-43 Gap junction 43 kDa heart protein protein protein rat Rattus norvegicus (Rat) Rat MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI DIP protein P08050 original sequence version: 110 DIP protein P08050 original sequence version: 147 0196416EA6A69490 ubql4_human Ubiquilin-4 UBQLN4 C1orf6 UBIN Ataxin-1 ubiquitin-like-interacting protein A1U Ataxin-1 interacting ubiquitin-like protein CIP75 Connexin43-interacting protein of 75 kDa protein protein human Homo sapiens Human MAEPSGAETRPPIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLVIKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLNNPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFAAQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGISRTPAPSAGSNAGSTPEAPTSSPATPATSSPTGASSAQQQLMQQMIQLLAGSGNSQVQTPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS E57B9FFEF90793FE cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC gja1-ubqln4-1 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait er_targetting_sequence tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2A gja1-ubqln4-2 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey er_targetting_sequence tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2A, 4A/B, 5,6 lactacystin - proteasome inhibitor bortezomib -a proteasome inhibitor The subset of ER-localized Cx43 that interacts with CIP75 is not ubiquitinated. cdkn1b-gja1-1 1 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey er_targetting_sequence tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4A positive control for detecting ubiquitinated proteins. Use of a different Cx43 antibody failed to detect co-immunoprecipitated Cx43.