bhf-ucl Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. J. Cell Biol. (0021-9525) 2009 imex curation Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr Accepted 2014-MAY-14 by MGT J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. J. Cell Biol. (0021-9525) 2009 imex curation Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-ips Human- induced pluripotent stem cells ips cells Induced pluripotent stem cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins They use iPS Oct4-iA over expressing cells iPS cells used are human (confirmed by the author) michel.puceat@inserm.fr Accepted 2014-MAY-14 by MGT J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. J. Cell Biol. (0021-9525) 2009 imex curation Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-end-2 mouse-END-2 visceral_endoderm Visceral Endoderm like cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins Human Oct4-iA is over-expressed. If it is not over-expressed there is no binding. (The mouse Oct4-iA endogenous one is also present) END-2 cells: visceral-endoderm-like derivative of P19, an embryonic carcinoma cell line derived from an embryo-derived teratocarcinoma in mice. (ref. Mummery et al. 1991. PMID:1710586) michel.puceat@inserm.fr Accepted 2014-MAY-14 by MGT J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. J. Cell Biol. (0021-9525) 2009 imex curation Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr Accepted 2014-MAY-14 by MGT J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation q01860-1 POU domain, class 5, transcription factor 1 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 3 Octamer-binding protein 4 Octamer-binding transcription factor 3 Oct-3A Oct3A protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN mint 934C58DAEA0C535B nkx25_human_gene Homeobox protein Nkx-2.5 NKX2-5 CSX NKX2.5 NKX2E Cardiac-specific homeobox Homeobox protein CSX Homeobox protein NK-2 homolog E gene gene human Homo sapiens Human po5f1_human POU domain, class 5, transcription factor 1 Octamer-binding transcription factor 3 Octamer-binding protein 3 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 4 protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN DIP protein Q01860 original sequence version: 131 DIP protein Q01860 original sequence version: 150 DIP protein Q01860 original sequence version: 138 934C58DAEA0C535B tbx6_human_gene T-box transcription factor TBX6 TBX6 gene gene human Homo sapiens Human sox2_human Transcription factor SOX-2 SOX2 protein protein human Homo sapiens Human MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM DIP protein P48431 original sequence version: 127 DIP protein P48431 original sequence version: 117 EFCCAFE3E3A2B67B smad4_human Mothers against decapentaplegic homolog 4 SMAD4 DPC4 MADH4 SMAD family member 4 Deletion target in pancreatic carcinoma 4 protein protein human Homo sapiens Human MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD DIP protein Q13485 original sequence version: 149 DIP protein Q13485 original sequence version: 177 7EE3C4647712DA90 sox17_human_gene Transcription factor SOX-17 SOX17 gene gene human Homo sapiens Human sox2_human_gene Transcription factor SOX-2 gene gene gene human Homo sapiens Human sox17_mouse Transcription factor SOX-17 Sox17 Sox-17 protein protein mouse Mus musculus Mouse MSSPDAGYASDDQSQPRSAQPAVMAGLGPCPWAESLSPLGDVKVKGEVVASSGAPAGTSGRAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALVEPQAGALGPEGGRVAMDGLGLPFPEPGYPAGPPLMSPHMGPHYRDCQGLGAPALDGYPLPTPDTSPLDGVEQDPAFFAAPLPGDCPAAGTYTYAPVSDYAVSVEPPAGPMRVGPDPSGPAMPGILAPPSALHLYYGAMGSPAASAGRGFHAQPQQPLQPQAPPPPPQQQHPAHGPGQPSPPPEALPCRDGTESNQPTELLGEVDRTEFEQYLPFVYKPEMGLPYQGHDCGVNLSDSHGAISSVVSDASSAVYYCNYPDI 14233EED2CCDD69D pou5f1-sox17-1 3 5 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Fig. 2I pou5f1-sox2-4 4 7 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2C, 3B, 4B Oct4-iA over-expression Conditioned medium from Oct4-iA over-expressing cells pou5f1-sox17-4 4 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 2D, H, 3B, 4B Oct4-iA over-expression Oct4-iA over-expression + Sox2 shRNA Conditioned medium of Oct4-iA over-expressing cells Oct4-iA over-expression + Sox2 Oct4-iA over-expression + Sox17 shRNA pou5f1-sox17-5 2 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. S3E pou5f1-sox2-5 1 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 2F Oct4-iA over-expression significantly reduces the interaction pou5f1-sox17-7 4 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2B BMP2 pou5f1-sox2-6 4 12 unspecified role unspecified role prey prey distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 2A BMP2 smad4-nkx2_5 4 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. S3A Oct 4-iA overexpression smad4-tbx6-1 4 8 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. S3A Oct 4-iA overexpression