bhf-ucl OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of GST-OBFC1 is human as per author statement in text. The sequence of the single stranded telomeric sequence TelG31 is human as per author statement in text. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-htc75 Homo sapiens htc75 htc75 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins Nuclear extracts were incubated with anti-mTPP1 antibodies, the proteins in the immunoprecipitates were resolved on SDS-PAGE, and stained with Coomassie Blue. The lanes were sectioned and excised for sequencing on a liquid chromatography tandem mass spectrometer. The source of the following proteins is mouse as they are endogenous to the mouse cell line used as per author statement: pot1, trf2, rap1, trf1, tpp1, tin2, obfc1. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins Anti-GST antibodies were added to the binding mixtures containing the highest concentration of GST-OBFC1 and ssDNA. The source of GST-OBFC1 is human as per author statement in text. The sequence of the single stranded telomeric sequence TelG31 is human as per author statement in text. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-htc75 Homo sapiens htc75 htc75 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The construct pairs were analysed by flow cytometry. The source of YFP-tagged TPP1, OBFC1 and mutants is human as per author statement in text. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of the following proteins is mouse as they are endogenous to the mouse cell line used as per author statement: tpp1 and obfc1. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of the proteins OBFC1 and TPP1 is human as endogenous to HeLa cell line used or as per author statement. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of YFP-tagged TPP1, OBFC1 and mutants is human as per author statement in text. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. J. Biol. Chem. (0021-9258) 2009 imex curation Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of bacterially expressed GST-OBFC1 is human as per author statement in text. RAP1 is human as it is endogenous to human cell line used U2OS. songyang@bcm.edu Accepted 2013-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2009 imex curation stn1_human CST complex subunit STN1 STN1 OBFC1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein human Homo sapiens Human MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF DIP protein Q9H668 original sequence version: 89 087E7EF75544A1F0 terf2_human Telomeric repeat-binding factor 2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein TERF2 TRF2 TRBF2 protein protein human Homo sapiens Human MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN DIP protein Q15554 original sequence version: 107 DIP protein Q15554 original sequence version: 109 DIP protein Q15554 original sequence version: 121 DIP protein Q15554 original sequence version: 157 DIP protein Q15554-3 original sequence version: 115 3A278AC6B594C43A tinf2_mouse TERF1-interacting nuclear factor 2 Tinf2 Tin2 TRF1-interacting nuclear protein 2 protein protein mouse Mus musculus Mouse MAPPPGVGPASLRFAAAASWLVVRRRRVEHFPKVVEFLQSLRAAAPGLVCYRHHERLCMSLKAKVVVELILQARPWDQVLNALKHHFPAESRTTKEDRKLLEARENFCLLVKHLSEDPPSSLQELEQDYGESFLVAMEKLLFEYLCQLEKALPPVRAQELQDALSWSQPGSFITSSVALHQYGMDMGWTFPESSTSGSGNLIEPMEESPHQQTRPAFHSPLPKAKLGPHQPASLEHPEHLAGHRFNLAPLGKRKSRSHWTSAKACHKERPTVMLLPFRNMGLPAQDLSNPKSREEPGAASAASVGTEPVCTEEAKTPSRPLGKRALEETPPDSPAASRRTV 41A07CE00DC2B4D7 te2ip_mouse Telomeric repeat-binding factor 2-interacting protein 1 Terf2ip Rap1 Repressor/activator protein 1 homolog MNCb-0448 MNCb-0628 protein protein mouse Mus musculus Mouse MAEAMDLGKDPNGPTHSSTLFVREDGSAMSFYVRPSSAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVDRNEKLDLEAYRLGLTEQASDPKPGASTEGSTEPEPQPLTGRIAYTDAEDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGNAPVSPSSQKLKRKAEQDPEAADSGEPQNKRAPDLPEEECVKGEIKENGEADNKLFEEAAPEFGEAVVDESPDFEIHITMCDGDPPTPEEDSETQPDEEEEEPKVSTQEVGTAIKVIRQLMEKFNLDLSTVTQALLKNSGELEATSSFLESGRRPDGYPIWCRQDDLDLQKDDDDTKNALVKKFGAQNVARRIEFRKK mint May play a role in telomere length regulation 7A15CFD83733BE2D telg31 5-GTTAGGGTTAGGGTTAGGGTTAGGGTTAGGG-3 ss dna single stranded deoxyribonucleic acid ss DNA ss dna human Homo sapiens Human GTTAGGGTTAGGGTTAGGGTTAGGGTTAGGG acd_mouse Adrenocortical dysplasia protein Acd protein protein mouse Mus musculus Mouse MSDSGLLALQPWIRELILGSETLSSPRTGQLLKVLQDSETPGPSSAPDTPDTGAVLLVSDGTHSVRCVVTRNAIDTSDWEEKELGFRGTEGRLLLLQACGLRVQVAQDHAPAEFYLQVDRFNLLPTEQPRIQVTGCNQDSDVQRKLNECLEDHLSESASSSAGLTLSQLLDEVREDQDHRGALVCLAKSCLVLKGPCTTTPLTDWITSGSQALGKAVFTVSGSLLHIPEGEEQILSSTGSSQKARGTSASPSHMPLEESGASVSLLSALATSDPGQMDSSQSPPAVGSTSPRAQAPTSPPCNSTPSSLLLNCSPSLSPLHPAPRSHQSCETRAQAPKLEFQCSFKKRQLLPRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVAWALNIVMESESELTQV 357CB31A8C4639BF stn1_mouse CST complex subunit STN1 Stn1 Alpha-accessory factor of 44 kDa Obfc1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein mouse Mus musculus Mouse MPQPCLLMECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGSVRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILNCVHLNLRWDLSKAVLQRVLELLEDQSDIVSTADHYYAAF 23C7FC13A10C6F1F terf1_mouse Telomeric repeat-binding factor 1 Terf1 Trf1 TTAGGG repeat-binding factor 1 protein protein mouse Mus musculus Mouse MAETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVASGKALDAQFEVDERITPLESALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAEEVFERIFGDPEFYTPLERKLLKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSSTFLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSSIRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCVSENQPDTDDKSGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLIS DIP protein P70371 original sequence version: 123 3F648F18C3ECF20A acd_human Adrenocortical dysplasia protein homolog POT1 and TIN2-interacting protein ACD PIP1 PTOP TINT1 TPP1 protein protein human Homo sapiens Human MAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQEHQGALVCLAESCLTLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPSSSGTPALPGHMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICSAPATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQALVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQAVRLPPQLMAWALHFLMDAQPGSEPTPM DIP protein Q96AP0 original sequence version: 34 DIP protein Q96AP0-1 original sequence version: 86 DIP protein Q96AP0-1 original sequence version: 105 DIP protein Q96AP0 original sequence version: 105 DIP protein Q96AP0-1 original sequence version: 75 6EA98FFC753E9A10 pote1_mouse Protection of telomeres protein 1 Pot1 Pot1a POT1-like telomere end-binding protein protein protein mouse Mus musculus Mouse MSLVSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQTNVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAFLLKVWDGTQTVLPSWRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIEVGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGTSYGRGIRVLPDTSPCVDQLKKALEGANLPVTETSTGICQSENGDSSALSNSGSGAVSPYEEERCQQVSATILTNHQHLEKTPLCAILTQKAPQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSVQEVPHGDSLDKILQDAATEAPDIKLKATSLYYSKVWTTEDQGGRQVAVHFVKNNGILPASSECLILIEGGRLCEVSKLSSKFHSVMPVRSGPESLELLTLSAPFLIQGKVHHYGCKQCSSLKPIQNLNSRFHKGPWTPSSVAEALGVVPLQYVFVMVFTLDDGTGVLEAYLKDSEHFFKIPASEVLTDDDLQRSLETIMDMICPPGIKVDAYPWLECLLKSYNVTIGTERRICYQIFDTTVAENVV DIP protein Q91WC1 original sequence version: 46 DIP protein Q91WC1 original sequence version: 77 mint Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity 64393BA48F14965E terf2_mouse Telomeric repeat-binding factor 2 Terf2 Trf2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein protein protein mouse Mus musculus Mouse MAAGAGTAGPASGPGVVRDPMASQPRKRPSREGGEGGEGERRSNTMAGGGGSSDSSGRAASRRASRSGGRARRGRHEPGLGGAAERGAGEARLEEAVNRWVLKFYFHEALRAFRSSRYRDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTDSMVESSRKLVKEAAVIICIKNKEFEKASKILKKYMSKDPTTQKLRTDLLNIIREKNLAHPVIQNFSYEVFQQKMLRFLESHLDDTEPYLLTMAKKALKSESAASSTMREEKHPEPVEKPLREPPSRQPQNPPATIGIRTLKAAFKALSTAQDSEAAFAKLDQKDLVLANLASPSSPAHKHKRPRKDEHESAAPAEGEGGSDRQPRNSPMTISRLLLEEDSQSTEPSPGLNSSHKAMSASKPRALNQPHPGEKKPKASKDKWNSPNGLEEKEVWLEEDQLFEVQAPGEDRSSSLTRKQKWTIEESEWVKDGVRKYGEGNWAAISKSYPFVNRTAVMIKDRWRTMKKLGMN 2788F7322506182C te2ip_human Telomeric repeat-binding factor 2-interacting protein 1 DRIP5 TERF2IP RAP1 PP8000 Dopamine receptor-interacting protein 5 Repressor/activator protein 1 homolog protein protein human Homo sapiens Human MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDAPVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK DIP protein Q9NYB0 original sequence version: 102 DIP protein Q9NYB0 original sequence version: 146 DIP protein Q9NYB0 original sequence version: 145 DIP protein Q9NYB0 original sequence version: 108 EAA615777F9D3D3D acd-obfc1-1 3 19 unspecified role unspecified role prey prey cell lysate cell lysate 13 unspecified role unspecified role prey prey cell lysate cell lysate 12 unspecified role unspecified role prey prey cell lysate cell lysate 16 unspecified role unspecified role prey prey cell lysate cell lysate 15 unspecified role unspecified role bait bait cell lysate cell lysate 20 unspecified role unspecified role prey prey cell lysate cell lysate 17 unspecified role unspecified role prey prey cell lysate cell lysate association association Figure 1 A obfc1-acd-1 7 18 unspecified role unspecified role prey prey cell lysate cell lysate 10 unspecified role unspecified role bait bait cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2 B acd-obfc1-2 5 10 unspecified role unspecified role neutral component neutral component living cell living cell yfp n-terminus fragment tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role neutral component neutral component living cell living cell binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain yfp c-terminus fragment tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figures 2 C & D acd-obfc1-3 5 18 unspecified role unspecified role neutral component neutral component living cell living cell yfp n-terminal fragment tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component living cell living cell binding region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain The OBFC1-deltaC-YFPc construct shows stronger binding to YFPn-TPP1 than either whole length OBFC1-YFPc or OBFC1-deltaN100-YFPc constructs. This indicates that the N-terminus containing the OB region (1-156) may inhibit TPP1-OBFC1 interaction. yfp c-terminal fragment tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2 E acd-obfc1-4 8 18 unspecified role unspecified role neutral component neutral component living cell living cell yfp n-terminal fragment tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component living cell living cell yfp c-terminal fragment tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain physical association physical association Figure 2 F telg31-obfc1 1 10 antibody detection identification by antibody antibody detection autoradiography autoradiography unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9bact Bacteria 14 unspecified role unspecified role bait bait 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 3 A obfc1-terf2ip-1 9 21 unspecified role unspecified role neutral component neutral component fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component fixed cell fixed cell colocalization colocalization Figure 3 B obfc1-terf2-4 2 11 unspecified role unspecified role neutral component neutral component fixed cell fixed cell 10 anti-tag immunocytochemistry anti-tag immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component fixed cell fixed cell binding region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 3 C telg31-obfc1-1 4 10 antibody detection identification by antibody antibody detection autoradiography autoradiography unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9bact Bacteria 14 unspecified role unspecified role bait bait 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 3 A acd-obfc1-5 6 15 unspecified role unspecified role bait bait cell lysate cell lysate 16 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association Figure 2 A