bhf-ucl Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. J. Exp. Med. (0022-1007) 2007 imex curation Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins The nuclear extracts were preincubated with anti-NF-IL6 followed by EMSA sakira@biken.osaka-u.ac.jp Accepted 2014-APR-10 by MGT J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. J. Exp. Med. (0022-1007) 2007 imex curation Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp Accepted 2014-APR-10 by MGT Human lung Matchmaker cDNA library J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. J. Exp. Med. (0022-1007) 2007 imex curation Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp Accepted 2014-APR-10 by MGT J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. J. Exp. Med. (0022-1007) 2007 imex curation Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp Accepted 2014-APR-10 by MGT J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation trib1_human Tribbles homolog 1 SKIP1 G-protein-coupled receptor-induced gene 2 protein TRIB1 C8FW GIG2 TRB1 protein protein human Homo sapiens Human MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSFFC 5F54E50924B1365B cebpb_mouse CCAAT/enhancer-binding protein beta Cebpb Interleukin-6-dependent-binding protein Liver-enriched transcriptional activator AGP/EBP protein protein mouse Mus musculus Mouse MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC DIP protein P28033 original sequence version: 133 DIP protein P28033 original sequence version: 135 DIP protein P28033 original sequence version: 131 827AC4AFC209AE89 c/ebp dna consensus Consensus C/EBP DNA binding sequence dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) TGCAGATTGCGCAATCTGCA trib1_mouse Tribbles homolog 1 Trib1 Trb1 protein protein mouse Mus musculus Mouse MRVGPVRFALSGASQPRGPGLLFPAARGTPAKRLLDTDDAGAVAAKCPRLSECSSPPDYLSPPGSPCSPQPPPSTQGTGGSCVSSPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKEFPIKHYQDKIRPYIQLPSHSNITGIVEVLLGESKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIIKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHVSPKARCLIRSLLRREPSERLTAPQILLHPWFEYVLEPGYVDSEIGTSDQIVPEYQEDSDISSFFC AD29BB4E640B4B62 cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC DIP protein P17676 original sequence version: 102 9B725BD6CCAA771D trib1-cebpb 3 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2B trib1-cebpb-2 4 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey n-terminal_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2A trib1-cebpb-3 2 9 unspecified role unspecified role prey prey n-terminal_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait physical association physical association no figure c_ebp_dna_consensus-cebpb-1 1 6 antibody detection identification by antibody antibody detection weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey mouse-macrophage Mus musculus macrophage macrophage Macrophage 7 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig 4B