bhf-ucl The role of beta2-glycoprotein I (beta2GPI) in the activation of plasminogen. The role of beta2-glycoprotein I (beta2GPI) in the activation of plasminogen. Biochim. Biophys. Acta (0006-3002) 2006 imex curation López-Lira F., Rosales-León L., Martínez V.M., Ruiz Ordaz B.H. Cardiac - Interactions involving cardiac related proteins bhro@servidor.unam.mx 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa tag visualisation tag visualisation López-Lira F., Rosales-León L., Martínez V.M., Ruiz Ordaz B.H. Cardiac - Interactions involving cardiac related proteins Biotinylated Glu-Plasminogen was incubated with the immobilised Beta2-GPI. The plate was washed to get rid of unbound Glu-Plasminogen and then incubated with streptavidin-peroxidase conjugate. The ranges of K5sp are not given in the publication and can not be traced bhro@servidor.unam.mx Accepted 2014-SEP-01 by MGT Biochim. Biophys. Acta (0006-3002) 2006 Only protein-protein interactions imex curation plmn_human Plasminogen PLG protein protein human Homo sapiens Human MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 8B31CB877CCB3AB6 apoh_human Beta-2-glycoprotein 1 APOH B2G1 Beta-2-glycoprotein I Apolipoprotein H Activated protein C-binding protein APC inhibitor Anticardiolipin cofactor protein protein human Homo sapiens Human MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC DIP protein P02749 original sequence version: 131 63101704F8EDFE3F apoh-plg-2 1 3 unspecified role unspecified role bait bait human-serum Homo sapiens serum Serum 2 unspecified role unspecified role prey prey k5sp domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-serum Homo sapiens serum Serum direct interaction direct interaction Fig. 1, 2A, B, C EACA (Epsilon Amino Caproic Acid), NaCl apoh-plg-3 1 2 competitor competitor competitor unspecified role unspecified role k5 sp domain required to bind necessary binding region required to bind range range range range Biotinylated Glu-Plasminogen and miniplasminogen or K5-sp were incubated with the immobilised β2GPI for a binding competition assay 3 unspecified role unspecified role bait bait human-serum Homo sapiens serum Serum 2 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-serum Homo sapiens serum Serum direct interaction direct interaction Fig.2B