bhf-ucl Apolipoprotein A-I activates Cdc42 signaling through the ABCA1 transporter. Apolipoprotein A-I activates Cdc42 signaling through the ABCA1 transporter. J. Lipid Res. (0022-2275) 2006 imex curation Nofer J.R., Remaley A.T., Feuerborn R., Wolinnska I., Engel T., von Eckardstein A., Assmann G. Cardiac - Interactions involving cardiac related proteins The source of ABCA1 is human as it is endogenous to the human fibroblasts cell line used. The source of GFP-ABCA1 and derivatives is human as stated by author under materials and methods. The source of CDC42 is human as it is endogenous to the human fibroblast and HEK293 cell lines used. nofer@uni-muenster.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Nofer J.R., Remaley A.T., Feuerborn R., Wolinnska I., Engel T., von Eckardstein A., Assmann G. Cardiac - Interactions involving cardiac related proteins The source of ABCA1 is human as it is endogenous to the human fibroblasts cell line used. The source of GFP-ABCA1 and derivatives is human as stated by author under materials and methods. The source of CDC42 is human as it is endogenous to the human fibroblast and HEK293 cell lines used. nofer@uni-muenster.de Accepted 2013-DEC-05 by ORCHARD J. Lipid Res. (0022-2275) 2006 imex curation Apolipoprotein A-I activates Cdc42 signaling through the ABCA1 transporter. Apolipoprotein A-I activates Cdc42 signaling through the ABCA1 transporter. J. Lipid Res. (0022-2275) 2006 imex curation Nofer J.R., Remaley A.T., Feuerborn R., Wolinnska I., Engel T., von Eckardstein A., Assmann G. Cardiac - Interactions involving cardiac related proteins The source of ABCA1 is human as it is endogenous to the human fibroblasts cell line used. The source of GFP-ABCA1 and derivatives is human as stated by author under materials and methods. The source of CDC42 is human as it is endogenous to the human fibroblast and HEK293 cell lines used. nofer@uni-muenster.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Nofer J.R., Remaley A.T., Feuerborn R., Wolinnska I., Engel T., von Eckardstein A., Assmann G. Cardiac - Interactions involving cardiac related proteins The human skin fibroblast cell line used is cultured from biopsies of adult human hip skin. The source of ABCA1 is human as it is endogenous to the human fibroblasts cell line used. The source of GFP-ABCA1 and derivatives is human as stated by author under materials and methods. The source of CDC42 is human as it is endogenous to the human fibroblast and HEK293 cell lines used. nofer@uni-muenster.de Accepted 2013-DEC-05 by ORCHARD J. Lipid Res. (0022-2275) 2006 imex curation cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF abca1_human Phospholipid-transporting ATPase ABCA1 ATP-binding cassette transporter 1 Cholesterol efflux regulatory protein ABCA1 ABC1 CERP ATP-binding cassette sub-family A member 1 protein protein human Homo sapiens Human MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSDMRQEVMFLTNVNSSSSSTQIYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNGSVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTGITPGSIELPHHVKYKIRMDIDNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEKKTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHPGSNQKRISEICMEEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTGTLELLNALTKDPGFGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLPPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQALPPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDHLKDLSLHKNQTVVDVAVLTSFLQDEKVKESYV DIP protein O95477 original sequence version: 70 DIP protein O95477 original sequence version: 169 21A2CF8F3F518D6D abca1-cdc42-2 1 4 unspecified role unspecified role bait bait cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal O95477:p.Lys939Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K M Wed May 02 18:13:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys939met' Tue Jun 30 19:35:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys939Met' 3 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association Figure 5 E upper panel Cells were pre-treated with human ApoA-I for 10 min with (10 μg/ml) which substantially increased the amount of Cdc42 immunoprecipitated from lysates obtained from skin fibroblasts or from ABCA1-GFP lysates but not from ABCA1-W-GFP or ABCA1-ΔC-GFP lysates. These results indicate that ABCA1 interacts with Cdc42 and that the exposure of ABCA1-expressing cells to apoA-I results in the formation of an Cdc42-ABCA1 complex. abca1-cdc42-4 2 4 unspecified role unspecified role bait bait cell lysate cell lysate 3 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association Figure 5 E lower panel T0901317 (liver X receptor (LXR) agonist) and R0264456 (retinoid X receptor (RXR agonist). Could not find an ID for R0264456 in Chembl, Chebi or even general search in google, hence no xref. ApoA-I (P02647)