bhf-ucl Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Nat. Cell Biol. (1465-7392) 2005 imex curation Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Nat. Cell Biol. (1465-7392) 2005 imex curation Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Human fetal kidney cDNA library Nat. Cell Biol. (1465-7392) 2005 imex curation Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-kidney Mus musculus kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins These experiments were done in a subset of MEK cells that were positive for DBA (a collecting duct marker) E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Nat. Cell Biol. (1465-7392) 2005 imex curation Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-kidney Mus musculus kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins These experiments were done in a subset of MEK cells that were positive for LTA (a proximal tubule marker) E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Nat. Cell Biol. (1465-7392) 2005 imex curation Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Nat. Cell Biol. (1465-7392) 2005 imex curation Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Nat. Cell Biol. (1465-7392) 2005 imex curation Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2. Nat. Cell Biol. (1465-7392) 2005 imex curation Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li X., Luo Y., Starremans P.G., McNamara C.A., Pei Y., Zhou J. Cardiac - Interactions involving cardiac related proteins E2A gene (P15806) encodes two alternatively spliced products: E12 and E47 which is P15806-2,the one studied in this publication. (ref. 27) zhou@rics.bwh.harvard.edu Accepted 2014-OCT-10 by ORCHARD Nat. Cell Biol. (1465-7392) 2005 imex curation p15806-2 Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQLHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL DIP protein P15806-2 original sequence version: 91 Contains a phosphothreonine at position 528. Contains a phosphoserine at position 533. 5C1B68DDBF29A93B id2_human DNA-binding protein inhibitor ID-2 Inhibitor of DNA binding 2 ID2 BHLHB26 Class B basic helix-loop-helix protein 26 Inhibitor of differentiation 2 protein protein human Homo sapiens Human MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG DIP protein Q02363 original sequence version: 133 DIP protein Q02363 original sequence version: 90 DIP protein Q02363 original sequence version: 144 A0D98B96396EB11E id2_mouse DNA-binding protein inhibitor ID-2 Id2 Id-2 Idb2 Inhibitor of DNA binding 2 Inhibitor of differentiation 2 protein protein mouse Mus musculus Mouse MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG DIP protein P41136 original sequence version: 92 A0D98D54F2686CC5 pkd1_mouse Polycystin-1 Pkd1 Autosomal dominant polycystic kidney disease 1 protein homolog protein protein mouse Mus musculus Mouse MPLGAPALLALALGLGLWLGALAGDPGRGCGPCPLPCFCGPAPDAACRVNCSGRWLQTLGPSLRIPADATALDLSHNLLQTLDIGLLVNLSALVELDLSNNRISTLEEGVFANLFNLSEINLSGNPFECNCGLAWLPRWAKEHQVHVVQSEATTCRGPIPLAGQPLLSIPLLDNACGEEYVACLPDNSSGAVAAVPFYFAHEGPLETEACSAFCFSAGEGLAALSEQNQCLCGAGQASNSSAACSSWCSSISLSLNSACGGPTLLQHTFPASPGATLVGPHGPLASGQPADFHITSSLPISSTRWNFGDGSPEVDMASPAATHFYVLPGSYHMTVVLALGAGSALLETEVQVEATPTVLELVCPSFVHSNESLELGIRHRGGSALEVTYSILALDKEPAQVVHPLCPLDTEIFPGNGHCYRLVAEKAPWLQAQEQCRTWAGAALAMVDSPAIQHFLVSKVTRSLDVWIGFSSVEGTEGLDPRGEAFSLESCQNWLPGEPHPATAEHCVRLGPAGQCNTDLCSAPHSYVCELRPGGPVWDTENFVMGMSGGGLSGPLHPLAQQETVQGPLRPVEVMVFPGLSPSREAFLTAAEFSTQKLEEPAQMRLQVYRPSGGAAAVPEGSSEPDNRTEPAPKCVPEELWCPGANVCIPFDASCNSHVCINGSVSRLGLSRASYTLWKEFFFSVPAGPPTQYLVTLHSQDVPMLPGDLIGLQHDAGPGTLLQCPLASSCPGQALYLSTNASDWMTNLPVHLEEAWAGPVCSLQLLLVTERLTPLLGLGPNPGLQHPGHYEVRATVGNSVSRQNLSCSFSVVSPIAGLRVIHPIPLDGHIYVPTNGSVLVLQVDSGANATATAQWFGGNISAPFEDACPPEVDFLKQDCTEEANGTLFSVLMLPRLKEGDHTVEIVAQNGASQANLSLRVTAEEPICGLRAVPSPEARVLQGILVRYSPMVEAGSDVAFRWTIDDKQSLTFHNTVFNVIYQSAAIFKLSLTASNHVSNITVNYNVTVERMNKMHGLWVSAVPTVLPPNATLALTGGVLVDSAVEVAFLWNFGDGEQVLRQFKPPYDESFQVPDPTVAQVLVEHNTTHIYTTPGEYNLTVLVSNTYENLTQQVTVSVRTVLPNVAIGMSSNVLVAGQPITFSPYPLPSTDGVLYTWDFGDGSPVLIQSQPVLNHTYSMTGAYRITLEVNNTVSSVTAHADIRVFQELHGLTVYLSPSVEQGAPMVVSASVESGDNITWTFDMGDGTVFTGPEATVQHVYLRAQNFTVTVEAANPAGHLSQSLHVQVFVLEVLHIEPSTCIPTQPSAQLMAHVTGDPVHYLFDWTFGDGSSNVTVHGHPSVTHNFTRSGIFPLALVLSSHVNKAHYFTSICVEPEIRNITLQPERQFVKLGDEARLVAYSWPPFPYRYTWDFGTEDTTHTQTGGSEVKFIYREPGSYLVIVTVSNNISSTNDSAFVEVQEPVLVTGIRINGSHVLELQQPYLLSAMGSGSPATYLWELGDGSQSEGPEVTHIYSSTGDFTVRVSGWNEVSRSEAQLNITVKQRVRGLTINASRTVVPLNGSVSFSTLLEVGSDVHYSWVLCDRCTPIPGGPTISYTFRSVGTFNIIVTAENEVGSAQDSIFIYVLQFIEGLQVAGGDNGCCFPTNYTLQLQAAVRDGTNISYSWTAQQEGSLITLFGSGKCFSLTSLKASTYYVHLRATNMLGSAAANRTIDFVEPVESLILSASPNPAAVNMSLTLCAELAGGSGVVYTWYLEEGLSWKTSMPSTTHTFAAPGLHLVRVTAENQLGSVNATVEVAIQVPVGGLSIRTSEPDSIFVAAGSTLPFWGQLAEGTNVTWCWTLPGGSKDSQYIAVRFSTAGSFSLQLNASNAVSWVSAMYNLTVEEPIVNLMLWASSKVVAPGQPVHFEILLAAGSALTFRLQVGGSVPEVLPSPHFSHSFFRVGDHLVNVQAENHVSHAQAQVRILVLEAVVGLQVPNCCEPGMATGTEKNFTARVQRGSRVAYAWYFSLQKVQGDSLVILSGRDVTYTPVAAGLLEIHVRAFNELGGVNLTLMVEVQDIIQYVTLQSGRCFTNRSARFEAATSPSPRRVTYHWDFGDGTPVQKTEEFWADHYYLRPGDYHVEVNATNLVSFFVAQATVTVQVLACREPEVEVALPLQVLMRRSQRNYLEAHVDLRNCVSYQTEYRWEIYRTASCQRPGRMAQMVLPGVDVSRPQLVVPRLALPVGHYCFVFVVSFGDTPLARSIQANVTVAAERLVPIIEGGSYRVWSDTQDLVLDGSKSYDPNLEDGDQTPLNFHWACVASTQSETGGCVLNFGPRGSSVVTIPLERLEAGVEYTFNLIVWKAGRKEEATNQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSYVYLEGHCHNCSRGYKQGCWAARTFSNKTLVLNETTTSTGSTGMNLVVRPGALRDGEGYIFTLTVLGHSGEEEGCASIRLSPNRPPLGGSCRLFPLDSVRGLTTKVHFECTGWRDAEDGGAPLVYALLLKRCRQSYCENFCIYKGSLSTYGAVLPPGFQPLFVVSLAVVVQDQLGAAVVALNRSLTIVLPEPSGNPADLVPWLHSLTASVLPGLLKQADPQHVIEYSLALITVLNEYEQAPDVSEPNVEQQLRAQMRKNITETLISLRVNTVDDIQQITAALAQCMVSSRELMCRSCLKKMLQKLEGMMRILQAETTEGTLTPTTIADSILNITGDLIHLASLDMQGPQPLELGVEPPSLMVASKAYNLSSALMRILMRSRVLNEEPLTLAGEEIVALGKRSDPLSLLCYGKALGPSCHFSIPEAFSGALSNLSDVVQLIFLVDSNPFPFGYISNYTVSTKVASMAFQTQTGTQIPIEQLAAERAITVKVPNNSDQAAQSSHNPVGSTIVQPQTSVSAVVTADNSNPQAGLHLRITYTVLNERYLSAEPEPYLAVYLHSVSQPNEYNCSASRRISLEVLEGADHRLYTFFIAPGTGTLDRSYYLNLTSHFHWSALEVSVGLYTSLCQYFSEEMMMWRTEGIVPLEETSPSQAVCLTRHLTAFGASLFVPPSHVQFIFPEPSASINYIVLLTCVICLVTYVVMAMILRKLDQLDVSRVRVIPFCGKGGRFKYEILVKTGWSRGSGTTAHVGIMLYGEDNRSGHRHLDGDRAFHRNSLDIFQIATPHSLGSVWKIRVWHDNKGLSPAWFLQHIIVRDLQSARSTFFLVNDWLSVETEANGGLVEKEVLAANEAALWQFQRLLVAELQRGFFDKHIWLSIWDRPPRSRFTRVQRVTCCVLLLCLFLAANAVWYGVVRDTTYSMGPVSSLISPGVDTVAIGLVSSVVVYPVYLAVLFLFRMSRSKVSGDQNPTPTGQQALDVDSYLDPSVLDSSLLTLSGLTEAFAGQVKNDLFLEDAKSLVCWPSSEGTLSWPDLLSDPSVVSSTLQRLTQGRPGCMLGSEEDGASLVSPSLPAKYLSASDEDLIHQVLADGANNLVPTQDTLLETDLLTSLSSVPGEKTETLILQTVGEERPASMGLSWEQSPVTRLSRTGLVEGFQKRLLPAWCAPLAHGLSLLLVAVAVAVSGWIGASFPPSVSVMWLLSSSSSFLASFLGWEPLKVLLEALYFSLVAKRLHPDEDDTLVESPAVTPVSERVPRVRPPHGFALFLAKEEARKVKRLHDMLKRLLVYMLFLLVTLLANYGDASCHGHAYRLQSAIKQELDSQAFLAITRSDEFWPWMSHVFLPYVHGNQSSPELGPPRLRQVRLQEAFCPDPSSSEHMCSAAGSLSTSDYGIGWQSVVQNGSETWAYSAPDLLGAWYWGYCAVYDSGGYIQELGLSLEESRARLGFLQLHNWLDSRSRAVFVELTRYSPAVGLHAAVTLRLEFPVAGHALAAFSVRPFALRRLSTGLSLPLLTSVCLLLFALYFSMAEVQTWRKDGCACTARPDTWARCLLVILTAATGLVRLAQLGIADRQWTHFVQDHPRHFTSFDQVAQLGSVARGLAASLLFLLLVKAAQQLRFVRQWSVFGKTLCRALPELMGATLGLVLLGVAYAQMAILLISSGADTLYNMARAFLVLCPGARVPTLCPSESWYLSPLLCVGLWALRVWGALRLGAILLRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLWMGFSKVKEFRHKVRFEGMDPLPSRSSRGSKSSPVVLPPSSGSEASHPSTSSSQPDGPSASLSRSTLKLEPEPSRLHAVFESLLVQFDRLNQATEDVYQLEQQLQSLQGHGHNGPPSSPSPGCFPGSQPALPSRLSRASQGLDQTVGPNRVSLWPNNKVHPSST DIP protein O08852 original sequence version: 103 FA12403171DBBCE0 pkd2_mouse Polycystin-2 Pkd2 Polycystic kidney disease 2 protein homolog TRPP2 Transient receptor potential cation channel subfamily P member 2 protein protein mouse Mus musculus Mouse MVNSRRVQPQPPGDAGRSPAPRASGPGRLVAGGAGLAVPGGLGEQRGLEIEMERIRQAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEDDDDDEVEGEEGGMVVEMDVEWRPGSRRSASSSAVSSVGARGRGLGSYRGAAHLSGRRRRLEDQGAQCPSPAGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHTQADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYRMSNAEGLLQFLEDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTVDAISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDLDLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDARLGRDSEIHREQMERLVREELERWESDDAASQTGHGVSTQVGLGGQPHPRNPRPPSSQSAEGLEGGGGNGSANVHA DIP protein O35245 original sequence version: 130 59B96AB3AE5226D3 pkd2_human Polycystin-2 PKD2 Polycystic kidney disease 2 protein Autosomal dominant polycystic kidney disease type II protein Polycystwin R48321 TRPP2 Transient receptor potential cation channel subfamily P member 2 protein protein human Homo sapiens Human MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV Functions as a calcium permeable cation channel. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis Defects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2) [MIM:173900]. ADPKD2 represents approximately 15% of the cases of ADPKD, a common genetic disease affecting about 1:400 to 1:1000 individuals. ADPKD is characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy mint F8D2E760EBEA8B47 pkd2-id2-1 3 14 unspecified role unspecified role bait bait c-terminal intracellular domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association pkd2-id2-2 1 14 unspecified role unspecified role bait bait carboxy-terminal intracellular domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey helix-loop-helix region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 23 21 physical association physical association Fig. 2A, 2B id2-pkd2-1 7 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13563:p.Ser812Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:49:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser812ala' Tue Jun 30 20:11:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser812Ala' 10 unspecified role unspecified role bait bait physical association physical association Fig. 2c pkd2-id2-4 6 14 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13563:p.Ser812Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:04:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser812ala' Tue Jun 30 17:57:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser812Ala' 10 unspecified role unspecified role prey prey physical association physical association Fig. 2c id2-pkd2-3 8 14 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physical association physical association Fig.2d, 4d, 4e Serine-phosphorylated PC2 was significantly increased in the PC1-overexpressing cells and in less extend in the PC2-overexpressing cells id2-pkd2-5 2 14 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3A id2-pkd2-8 4 12 unspecified role unspecified role ancillary ancillary 13 unspecified role unspecified role prey prey required phosphoser opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Fig. 6e In MEK cells with PKD1 del34/del34 or PKD1 null/null, PC2 is not phosphorylated and it does not interact with Id2 pkd2-id2-6 4 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait required phosphoser opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role ancillary ancillary association association Fig. 6e In MEK cells with PKD1 del34/del34 or PKD1 null/null, PC2 is not phosphorylated and it does not interact with Id2 pkd2-id2-9 4 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role ancillary ancillary association association Fig. 7b The triple interaction between PC2, Id2 and E47 is disrupted in MEK cells that have mutant PKD1del34/del34 or PKD1null/null id2-tcf3 4 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Fig. 7b Interaction between Id2 and E47 in MEK cells that have mutant PKD1del34/del34 or PKD1null/null is not disrupted tcf3-id2-3 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. 7b Interaction between Id2 and E47 in MEK cells that have mutant PKD1del34/del34 or PKD1null/null is not disrupted id2-pkd2-9 4 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role ancillary ancillary association association Fig. 7b The triple interaction between PC2, Id2 and E47 is disrupted in MEK cells that have mutant PKD1del34/del34 or PKD1null/null pkd2-id2-10 5 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role ancillary ancillary 13 unspecified role unspecified role bait bait association association Fig. 7b The triple interaction between PC2, Id2 and E47 is disrupted in MEK cells that have mutant PKD1del34/del34 or PKD1null/null pkd2-id2-10 5 13 unspecified role unspecified role bait bait required phosphoser opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role ancillary ancillary association association Fig. 6e In MEK cells with PKD1 del34/del34 or PKD1 null/null, PC2 is not phosphorylated and it doesn't interact with Id2 tcf3-id2-4 5 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. 7b Interaction between Id2 and E47 in MEK cells that have mutant PKD1del34/del34 or PKD1null/null is not disrupted id2-pkd2-10 5 13 unspecified role unspecified role prey prey required phosphoser opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role ancillary ancillary association association Fig. 6e In MEK cells with PKD1 del34/del34 or PKD1 null/null, PC2 is not phosphorylated and it doesn't interact with Id2 id2-pkd2-10 5 12 unspecified role unspecified role ancillary ancillary 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Fig. 7b The triple interaction between PC2, Id2 and E47 is disrupted in MEK cells that have mutant PKD1del34/del34 or PKD1null/null id2-tcf3-1 5 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Fig. 7b Interaction between Id2 and E47 in MEK cells that have mutant PKD1del34/del34 or PKD1null/null is not disrupted id2-pkd2-12 2 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 7a