bhf-ucl Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy. Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy. Cancer Res. (0008-5472) 2005 imex curation Togashi A., Katagiri T., Ashida S., Fujioka T., Maruyama O., Wakumoto Y., Sakamoto Y., Fujime M., Kawachi Y., Shuin T., Nakamura Y. Cardiac - Interactions involving cardiac related proteins yusuke@ims.u-tokyo.ac.jp. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Togashi A., Katagiri T., Ashida S., Fujioka T., Maruyama O., Wakumoto Y., Sakamoto Y., Fujime M., Kawachi Y., Shuin T., Nakamura Y. Cardiac - Interactions involving cardiac related proteins yusuke@ims.u-tokyo.ac.jp. Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2005 imex curation Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy. Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy. Cancer Res. (0008-5472) 2005 imex curation Togashi A., Katagiri T., Ashida S., Fujioka T., Maruyama O., Wakumoto Y., Sakamoto Y., Fujime M., Kawachi Y., Shuin T., Nakamura Y. Cardiac - Interactions involving cardiac related proteins yusuke@ims.u-tokyo.ac.jp. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-caki_1 Homo sapiens caki_1 Human clear-cell renal-cell carcinoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Togashi A., Katagiri T., Ashida S., Fujioka T., Maruyama O., Wakumoto Y., Sakamoto Y., Fujime M., Kawachi Y., Shuin T., Nakamura Y. Cardiac - Interactions involving cardiac related proteins This interaction was observed using two human renal carcinoma cell lines, caki-1 and caki-2. yusuke@ims.u-tokyo.ac.jp. Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2005 imex curation Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy. Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy. Cancer Res. (0008-5472) 2005 imex curation Togashi A., Katagiri T., Ashida S., Fujioka T., Maruyama O., Wakumoto Y., Sakamoto Y., Fujime M., Kawachi Y., Shuin T., Nakamura Y. Cardiac - Interactions involving cardiac related proteins yusuke@ims.u-tokyo.ac.jp. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-caki_2 Human renal cell carcinoma line Caki2 caki_2 Renal cell carcinoma cell line caki-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Togashi A., Katagiri T., Ashida S., Fujioka T., Maruyama O., Wakumoto Y., Sakamoto Y., Fujime M., Kawachi Y., Shuin T., Nakamura Y. Cardiac - Interactions involving cardiac related proteins This interaction was observed using two human renal carcinoma cell lines, caki-1 and caki-2. yusuke@ims.u-tokyo.ac.jp. Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2005 imex curation ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E hlpda_human_gene Hypoxia-inducible lipid droplet-associated protein HILPDA C7orf68 HIG2 Hypoxia-inducible gene 2 protein gene gene human Homo sapiens Human fzd10_human Frizzled-10 FZD10 FzE7 protein protein human Homo sapiens Human MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV E9B7E51FA7C87B26 hlpda_human Hypoxia-inducible lipid droplet-associated protein HILPDA C7orf68 HIG2 Hypoxia-inducible gene 2 protein protein protein human Homo sapiens Human MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM 91EA626A511FC8B7 hilpda-fzd10 1 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait his his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range The info about N-terminal position of His tag comes from info from the pET28a vector hydrophilic sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Fig. 5A fzd10-hilpda 1 6 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey hydrophilic sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 5A ctnnb1-hilpda 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. S3b P35222 increases expression at protein level of ENSG00000135245 Q9Y5L2 human HIG2 ctnnb1-hilpda-1 3 5 unspecified role unspecified role prey prey promoter binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association Fig. S3b P35222 increases expression at protein level of ENSG00000135245 Q9Y5L2 human HIG2