bhf-ucl Sortilin is essential for proNGF-induced neuronal cell death. Sortilin is essential for proNGF-induced neuronal cell death. Nature (0028-0836) 2004 imex curation Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) Fig 3D was not annotated because the interacting partners cannot be unambiguosly identified. The authors radioactively labelled the cells expressing both receptors, but they don't do a western blot to identify the prey. They have the control samples on the right of the figure that indicates the identity of the bands that show up in the autoradiography, but since this is a lysate sample we feel it is not enough to identify the proteins. an@biokemi.au.dk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink autoradiography autoradiography Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins Transfected 293 cells were incubated with radioiodinated pro NGF or mature NGF followed by crosslinking with with 1-ethyl-3-[3-dimethylaminopropyl] carbodiimide and DSS (Disuccinimidyl suberate). Cells were washed and lysed. The lysates were submitted to immunoprecipitation with the corresponding antibody. All precipitated proteins were analysed by SDS-PAGE and were detected by autoradiography. Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) an@biokemi.au.dk Accepted 2014-AUG-15 by PPORRAS Nature (0028-0836) 2004 imex curation Sortilin is essential for proNGF-induced neuronal cell death. Sortilin is essential for proNGF-induced neuronal cell death. Nature (0028-0836) 2004 imex curation Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) Fig 3D was not annotated because the interacting partners cannot be unambiguosly identified. The authors radioactively labelled the cells expressing both receptors, but they don't do a western blot to identify the prey. They have the control samples on the right of the figure that indicates the identity of the bands that show up in the autoradiography, but since this is a lysate sample we feel it is not enough to identify the proteins. an@biokemi.au.dk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-sm-11 cells Rat- vascular smooth muscle cells rat_sm-11 cells Rat- vascular smooth muscle cells crosslink cross-linking study crosslink autoradiography autoradiography Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins Transfected SM-11 cells were incubated with radioiodinated proNGF followed by crosslinking with 1-ethyl-3-[3-dimethylaminopropyl] carbodiimide and DSS (Disuccinimidyl suberate). Cells were washed and lysed. The lysates were submitted to immunoprecipitation with anti p75NTR. All precipitated proteins were analysed by SDS-PAGE and were detected by autoradiography. Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) an@biokemi.au.dk Accepted 2014-AUG-15 by PPORRAS Nature (0028-0836) 2004 imex curation Sortilin is essential for proNGF-induced neuronal cell death. Sortilin is essential for proNGF-induced neuronal cell death. Nature (0028-0836) 2004 imex curation Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) Fig 3D was not annotated because the interacting partners cannot be unambiguosly identified. The authors radioactively labelled the cells expressing both receptors, but they don't do a western blot to identify the prey. They have the control samples on the right of the figure that indicates the identity of the bands that show up in the autoradiography, but since this is a lysate sample we feel it is not enough to identify the proteins. an@biokemi.au.dk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins no The authors state that NGF binds sortilin with only a modest affinity and the biological relevance of this interaction is at best questionable. Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) an@biokemi.au.dk Accepted 2014-AUG-15 by PPORRAS 18-Sep-2014: Contacted by IntAct-Help. Nature (0028-0836) 2004 Only protein-protein interactions imex curation Sortilin is essential for proNGF-induced neuronal cell death. Sortilin is essential for proNGF-induced neuronal cell death. Nature (0028-0836) 2004 imex curation Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) Fig 3D was not annotated because the interacting partners cannot be unambiguosly identified. The authors radioactively labelled the cells expressing both receptors, but they don't do a western blot to identify the prey. They have the control samples on the right of the figure that indicates the identity of the bands that show up in the autoradiography, but since this is a lysate sample we feel it is not enough to identify the proteins. an@biokemi.au.dk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nykjaer A., Lee R., Teng K.K., Jansen P., Madsen P., Nielsen M.S., Jacobsen C., Kliemannel M., Schwarz E., Willnow T.E., Hempstead B.L., Petersen C.M. Cardiac - Interactions involving cardiac related proteins Human wild type Sortilin used in this paper confirmed in ref. 5 (Munk PC et al. 1999. PMID: 9927419) and by the author. TrK, P75NTR and neurotensin were human proteins (confirmed by the author). Vascular smooth muscle cells (SM-11) were from rat (confirmed by the author) an@biokemi.au.dk Accepted 2014-AUG-15 by PPORRAS Nature (0028-0836) 2004 imex curation p01138-pro_0000019600 Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA 122 241 4DBD80EDAFC2357F tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV DIP protein P07174 original sequence version: 124 DIP protein P07174 original sequence version: 106 B2E152D94D3827F8 ngf_human Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA DIP protein P01138 original sequence version: 170 DIP protein P01138 original sequence version: 144 DIP protein P01138 original sequence version: 121 DIP protein P01138 original sequence version: 172 619DFC65EB3BD671 ntrk1_human High affinity nerve growth factor receptor NTRK1 TRK Neurotrophic tyrosine kinase receptor type 1 TRK1-transforming tyrosine kinase protein p140-TrkA MTC TRKA Tropomyosin-related kinase A Tyrosine kinase receptor Tyrosine kinase receptor A gp140trk protein protein human Homo sapiens Human MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG DIP protein P04629 original sequence version: 203 DIP protein P04629 original sequence version: 192 6C15C721E336B601 sort_human Sortilin SORT1 Neurotensin receptor 3 Glycoprotein 95 100 kDa NT receptor protein protein human Homo sapiens Human MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE DIP protein Q99523 original sequence version: 97 DIP protein Q99523-1 original sequence version: 127 91F96A3035A4B43A neut_human Neurotensin/neuromedin N NTS protein protein human Homo sapiens Human MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY DIP protein P30990 original sequence version: 112 66E2E146DA08E3C7 p01138-pro_0000019599 NGF NGFB protein protein human Homo sapiens Human EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKR 19 121 833D5A1A6053936C tnr16_human Tumor necrosis factor receptor superfamily member 16 NGFR TNFRSF16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein human Homo sapiens Human MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSESTATSPV DIP protein P08138 original sequence version: 143 B09FA143FB3D625B sort1-ngf-1 3 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait luminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction Fig 1A The authors state that NGF binds (sortilin) with modest affinity but the biological relevance of this is at best questionable. sort1-ngf-1 4 9 unspecified role unspecified role bait bait luminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 11 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1A sort1-ngf-1 4 7 unspecified role unspecified role prey prey pro ngf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait luminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction Fig 1A, C sort1-ngf-1 4 12 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1A sort1-ngf-1 4 7 unspecified role unspecified role prey prey pro ngf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig 1A sort1-ngf-1 4 8 unspecified role unspecified role bait bait mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1A sort1-ngf-1 4 8 unspecified role unspecified role bait bait mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 7 unspecified role unspecified role prey prey pro ngf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1A sort1-ngf-1 4 11 competitor competitor competitor unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey pro ngf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait luminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction Fig 1c sort1-ngf-3 1 12 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role ancillary ancillary prongf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait physical association physical association Fig 3A ngfr-ngf-2 1 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role ancillary ancillary prongf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3A, 3B ngfr-ngf-1 1 5 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait physical association physical association Fig 3C Addition of unlabelled mature NGF almost abolishes the radio labelled signal. Sortilin (Q99523) Neurotensin (P30990) Unlabelled NGF (P01138-PRO_0000019600) ngfr-ngf-1 2 7 unspecified role unspecified role prey prey prongf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait physical association physical association Fig. 4B Unlabelled Pro NGF (P01138, 19-241aa) Neurotensin (P30990) sort1-ngf-1 4 10 competitor competitor competitor unspecified role unspecified role 7 unspecified role unspecified role prey prey pro ngf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait luminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction Fig 1C ntrk1-ngf-2 1 5 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait physical association physical association Fig 3C Sortilin (Q99523)