bhf-ucl The sonic hedgehog receptor patched associates with caveolin-1 in cholesterol-rich microdomains of the plasma membrane. The sonic hedgehog receptor patched associates with caveolin-1 in cholesterol-rich microdomains of the plasma membrane. J. Biol. Chem. (0021-9258) 2001 imex curation Karpen H.E., Bukowski J.T., Hughes T., Gratton J.P., Sessa W.C., Gailani M.R. Cardiac - Interactions involving cardiac related proteins human Ptc-GFP2construct (cDNA gift from Rune Toftgard) human Smo-GFP construct (gift from Carol Wicking), also used for smo-FLAG construct Myc-tagged caveolin-1 construct was a gift from Dr. Michael Lisanti. A Myc-Cav-1 construct is described by Lisanti in PMID:7608210 as canine, and therefore this is possibly the species of this construct. However, there is no link to a paper therefore myc-cav1 not annotated. Also no information about the Cav-1-GST fusion construct so Fig 5 and 6 cannot be annotated hkarpen@bcm.tmc.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Karpen H.E., Bukowski J.T., Hughes T., Gratton J.P., Sessa W.C., Gailani M.R. Cardiac - Interactions involving cardiac related proteins human Ptc-GFP2construct (cDNA gift from Rune Toftgard) human Smo-GFP construct (gift from Carol Wicking), also used for smo-FLAG construct Myc-tagged caveolin-1 construct was a gift from Dr. Michael Lisanti. A Myc-Cav-1 construct is described by Lisanti in PMID:7608210 as canine, and therefore this is possibly the species of this construct. However, there is no link to a paper therefore myc-cav1 not annotated. Also no information about the Cav-1-GST fusion construct so Fig 5 and 6 cannot be annotated hkarpen@bcm.tmc.edu Accepted 2013-OCT-03 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 imex curation The sonic hedgehog receptor patched associates with caveolin-1 in cholesterol-rich microdomains of the plasma membrane. The sonic hedgehog receptor patched associates with caveolin-1 in cholesterol-rich microdomains of the plasma membrane. J. Biol. Chem. (0021-9258) 2001 imex curation Karpen H.E., Bukowski J.T., Hughes T., Gratton J.P., Sessa W.C., Gailani M.R. Cardiac - Interactions involving cardiac related proteins human Ptc-GFP2construct (cDNA gift from Rune Toftgard) human Smo-GFP construct (gift from Carol Wicking), also used for smo-FLAG construct Myc-tagged caveolin-1 construct was a gift from Dr. Michael Lisanti. A Myc-Cav-1 construct is described by Lisanti in PMID:7608210 as canine, and therefore this is possibly the species of this construct. However, there is no link to a paper therefore myc-cav1 not annotated. Also no information about the Cav-1-GST fusion construct so Fig 5 and 6 cannot be annotated hkarpen@bcm.tmc.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Karpen H.E., Bukowski J.T., Hughes T., Gratton J.P., Sessa W.C., Gailani M.R. Cardiac - Interactions involving cardiac related proteins human Ptc-GFP2construct (cDNA gift from Rune Toftgard) human Smo-GFP construct (gift from Carol Wicking), also used for smo-FLAG construct Myc-tagged caveolin-1 construct was a gift from Dr. Michael Lisanti. A Myc-Cav-1 construct is described by Lisanti in PMID:7608210 as canine, and therefore this is possibly the species of this construct. However, there is no link to a paper therefore myc-cav1 not annotated. Also no information about the Cav-1-GST fusion construct so Fig 5 and 6 cannot be annotated hkarpen@bcm.tmc.edu Accepted 2013-OCT-03 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 imex curation ptc1_human Protein patched homolog 1 PTCH1 PTCH protein protein human Homo sapiens Human MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEERPRGSSSN DIP protein Q13635 original sequence version: 109 F2937247BC812F85 smo_human Smoothened homolog Protein Gx SMO SMOH protein protein human Homo sapiens Human MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF DIP protein Q99835 original sequence version: 115 8B4C459B34D13F83 g3h9i8_crigr Caveolin I79_007062 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRLNMQKEI 6BB1A0739CE2B330 g3h9i8-ptch1 2 5 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component gfp-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 1A ptch1-smo 2 4 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component living cell living cell flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role neutral component neutral component gfp-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 3C smo-ptch1 1 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait cell lysate cell lysate flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 polyclonal western polyclonal antibody western blot polyclonal western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate gfp-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 3B