bhf-ucl Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling. Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling. J. Biol. Chem. (0021-9258) 1999 imex curation Bafico A., Gazit A., Pramila T., Finch P.W., Yaniv A., Aaronson S.A. Cardiac - Interactions involving cardiac related proteins The author was contacted to inquire about Wnt-1 species but there was no reply after 2 weeks. Fig.2C experiment has not been annotated as the species of WNT-1-HFc is unknown. The construct is supposed to be referred at in (12) together with Wnt-2, but actually is not. Also WNT-1-HFc related data at Fig. 6A was not annotated for the same reason. Aaronson@smtplink.mssm.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bafico A., Gazit A., Pramila T., Finch P.W., Yaniv A., Aaronson S.A. Cardiac - Interactions involving cardiac related proteins The author was contacted to inquire about Wnt-1 species but there was no reply after 2 weeks. Fig.2C experiment has not been annotated as the species of WNT-1-HFc is unknown. The construct is supposed to be referred at in (12) together with Wnt-2, but actually is not. Also WNT-1-HFc related data at Fig. 6A was not annotated for the same reason. Aaronson@smtplink.mssm.edu Accepted 2013-SEP-11 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 1999 imex curation Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling. Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling. J. Biol. Chem. (0021-9258) 1999 imex curation Bafico A., Gazit A., Pramila T., Finch P.W., Yaniv A., Aaronson S.A. Cardiac - Interactions involving cardiac related proteins The author was contacted to inquire about Wnt-1 species but there was no reply after 2 weeks. Fig.2C experiment has not been annotated as the species of WNT-1-HFc is unknown. The construct is supposed to be referred at in (12) together with Wnt-2, but actually is not. Also WNT-1-HFc related data at Fig. 6A was not annotated for the same reason. Aaronson@smtplink.mssm.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Bafico A., Gazit A., Pramila T., Finch P.W., Yaniv A., Aaronson S.A. Cardiac - Interactions involving cardiac related proteins The author was contacted to inquire about Wnt-1 species but there was no reply after 2 weeks. Fig.2C experiment has not been annotated as the species of WNT-1-HFc is unknown. The construct is supposed to be referred at in (12) together with Wnt-2, but actually is not. Also WNT-1-HFc related data at Fig. 6A was not annotated for the same reason. Aaronson@smtplink.mssm.edu Accepted 2013-SEP-11 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 1999 imex curation wnt2_human Protein Wnt-2 WNT2 INT1L1 IRP Int-1-like protein 1 Int-1-related protein protein protein human Homo sapiens Human MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT AA96325BF68C4788 fzd6_human Frizzled-6 FZD6 protein protein human Homo sapiens Human MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT DIP protein O60353 original sequence version: 110 FBFF5844D6AB0223 sfrp1_human Secreted frizzled-related protein 1 SFRP1 FRP FRP1 SARP2 Secreted apoptosis-related protein 2 protein protein human Homo sapiens Human MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK 29DD948706EB7143 wnt2-sfrp1 1 5 unspecified role unspecified role prey prey crd region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role bait bait hfc fusion protein fusion protein predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 6A, B sfrp-sfrp 1 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 8 fzd6-sfrp1 1 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crd region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 4 unspecified role unspecified role bait bait crd region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 22 20 physical association physical association Fig. 9B fzd6-sfrp1-1 2 4 unspecified role unspecified role bait bait [35s] methionine [35s] cystenine 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crd region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 35s methionine 35s cycteine 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 10 sfrp1-fzd6-1 2 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range [35s] methionine [35s] cystenine 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crd region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 5 unspecified role unspecified role bait bait 35s methionine 35s cycteine 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 10