IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The C. elegans MDL-1 and MXL-1 proteins can functionally substitute for vertebrate MAD and MAX. The C. elegans MDL-1 and MXL-1 proteins can functionally substitute for vertebrate MAD and MAX. Oncogene (0950-9232) 1998 Yuan J., Tirabassi RS., Bush AB., Cole MD. Cancer - Interactions investigated in the context of cancer no contact email given only a correspondance address in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yuan J., Tirabassi RS., Bush AB., Cole MD. Cancer - Interactions investigated in the context of cancer no contact email given only a correspondance address In this ligand blotting assay, MDL-1 and MXL-1 were electrophoresed on SDS polyacrylamide gels, then transfered onto nylon membranes and allowed to renature. The membranes were probed with either 32P-labeled MDL-1 or MXL-1. Accepted 2007-FEB-1 by DAVET. Oncogene (0950-9232) 1998 The C. elegans MDL-1 and MXL-1 proteins can functionally substitute for vertebrate MAD and MAX. The C. elegans MDL-1 and MXL-1 proteins can functionally substitute for vertebrate MAD and MAX. Oncogene (0950-9232) 1998 Yuan J., Tirabassi RS., Bush AB., Cole MD. Cancer - Interactions investigated in the context of cancer no contact email given only a correspondance address in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yuan J., Tirabassi RS., Bush AB., Cole MD. Cancer - Interactions investigated in the context of cancer no contact email given only a correspondance address Accepted 2007-FEB-1 by DAVET. Oncogene (0950-9232) 1998 mdl1_caeel Mad-like protein 1 mdl-1 R03E9.1 protein protein caeel Caenorhabditis elegans MEQQLNLGHLLTAARLLDIGALDISSLDLGALTSTSSSPGSSSPAMFDLSNESELRSLFCGKLKVDKKQSSCASNASTSSQPYCSSPPARKSSKHSRTAHNELEKTRRANLRGCLETLKMLVPCVSDATRNTTLALLTRARDHIIELQDSNAAQMKKLNDLRDEQDELVAELAQLQADEEVAQATSQACQTLSQSRPESRASSFTSTSSRDSPCYLEYSPSSKPMDSHKPTIIDLYAEGLIPRGPITFPRPLVYPHNVFDLMNLPPTPFDVSQFLPINLQV DBC6A8C3919CA001 myc_max_consensus MYC/MAX vertebrate consensus binding sequence GATCCTGACGACCACGTGGTCTTACGCTAG dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) GATCCTGACGACCACGTGGTCTTACGCTAG 8EFDDCBDE33E5DDB max_mouse Protein max Myc-associated factor X Protein myn Myc-binding novel HLH/LZ protein Max Myn protein protein mouse Mus musculus Mouse MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS 86D133137727A57A myc_mouse Myc proto-oncogene protein Proto-oncogene c-Myc Transcription factor p64 Myc protein protein mouse Mus musculus Mouse MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA DIP protein P01108 original sequence version: 146 DIP protein P01108 original sequence version: 167 3FCA39BFFD6FC59E mxl1_caeel Max-like protein 1 mxl-1 T19B10.11 protein protein caeel Caenorhabditis elegans MSDMSDLEDDQTGHCGSGEHSGPFDPKRHAREQHNALERRRRDNIKDMYTSLREVVPDANGERVQASRAVILKKAIESIEKGQSDSATLSVDVAEQESKNAKLREEIARLKAKKDPSSSQSIIQ 8E780B9D00B82B0D mdl_1-mxl_1 2 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association 2 A When the MDL-1 binding reaction was supplemented with full length MXL-1 protein, a complex formed that bound tightly to the vertebrate MYC/MAX consensus sequence oligonucleotide max-mdl_1 2 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2 B MDL-1 could dimerize with mouse MAX and bind to the CACGTG sequence in an EMSA (Figure 2b), although the DNA binding activity of this interspecies heterodimer was much weaker than the intraspecies MDL-1/MXL-1 heterodimer The DNA binding of the MDL-1/MAX heterodimer was weaker than that of MDL-1/MXL-1. MDL-1 did not heterodimerize with mouse c-MYC. It is not specified what cell type the mouse MAX was expressed in. max-myc 2 6 unspecified role unspecified role neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component association association 2 B, C It is not specified what cell type the mouse MAX and MYC were expressed in. A control of mouse MYC with mouse MAX was included to demonstrate the MAX homodimer and MYC/MAX heterodimer shifts myc_max_consensu_max 2 4 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component physical association physical association 2 B, C It is not specified what cell type the mouse MAX was expressed in. A control of mouse MYC with mouse MAX was included to demonstrate the MAX homodimer and MYC/MAX heterodimer shifts mdl_1-mxl_1-1 1 7 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3 B These experiments revealed that 32P-labeled MXL-1 will only associate with MDL-1 The 32P-labeled MXL-1 does not bind the filter-bound MXL-1. mxl_1-mdl_1-2 1 3 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3 C The 32P-labeled MDL-1 does not bind the filter-bound MDL-1. 32P- labeled MDL-1 will only associate with MXL-1