IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor. Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor. Mol. Cell. Biol. (0270-7306) 1997 imex curation Lu R., Yang P., O'Hare P., Misra V. Cancer - Interactions investigated in the context of cancer The bait lacks the internal HCF repeats and 3-amino-1,2,4-triazole was used to suppress the background growth on His-lacking SD selective medium. misra@duke.usask.ca Human HeLa cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Lu R., Yang P., O'Hare P., Misra V. Cancer - Interactions investigated in the context of cancer The bait lacks the internal HCF repeats and 3-amino-1,2,4-triazole was used to suppress the background growth on His-lacking SD selective medium. misra@duke.usask.ca Accepted 2006-APR-24 by JYOTI. Human HeLa cDNA Mol. Cell. Biol. (0270-7306) 1997 Only protein-protein interactions imex curation Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor. Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor. Mol. Cell. Biol. (0270-7306) 1997 imex curation Lu R., Yang P., O'Hare P., Misra V. Cancer - Interactions investigated in the context of cancer The bait lacks the internal HCF repeats and 3-amino-1,2,4-triazole was used to suppress the background growth on His-lacking SD selective medium. misra@duke.usask.ca Human HeLa cDNA Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lu R., Yang P., O'Hare P., Misra V. Cancer - Interactions investigated in the context of cancer The bait lacks the internal HCF repeats and 3-amino-1,2,4-triazole was used to suppress the background growth on His-lacking SD selective medium. 6 misra@duke.usask.ca Accepted 2006-APR-24 by JYOTI. Human HeLa cDNA Mol. Cell. Biol. (0270-7306) 1997 Only protein-protein interactions imex curation Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor. Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor. Mol. Cell. Biol. (0270-7306) 1997 imex curation Lu R., Yang P., O'Hare P., Misra V. Cancer - Interactions investigated in the context of cancer The bait lacks the internal HCF repeats and 3-amino-1,2,4-triazole was used to suppress the background growth on His-lacking SD selective medium. misra@duke.usask.ca Human HeLa cDNA Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lu R., Yang P., O'Hare P., Misra V. Cancer - Interactions investigated in the context of cancer The bait lacks the internal HCF repeats and 3-amino-1,2,4-triazole was used to suppress the background growth on His-lacking SD selective medium. 7 misra@duke.usask.ca Accepted 2006-APR-24 by JYOTI. Human HeLa cDNA Mol. Cell. Biol. (0270-7306) 1997 Only protein-protein interactions imex curation vp16_bhv1p Tegument protein VP16 homolog Alpha-TIF Alpha trans-inducing protein protein protein bhv1p Bovine herpesvirus 1.1 (strain P8-2) (BoHV-1) Infectious bovine rhinotracheitis virus MSGRIKTAGRALASQCGGAAAATMDPYDAIEAFDDSLLGSPLAAGPLYDGPSPARFALPPPRPAPLAALLERMQAELGFPDGPALLRAMERWNEDLFSCLPTNADLYADAALLSADADAVVGAMYLAVPGDAERLDLNAHANQPLPAPPASEEGLPEYVAGVQAHFLAELRAREERYAGLFLGYCRALLQHLRATAARGRGAAGAGAQADRLRQLVAARYYREASRLARLAFAHMYVATAREVSWRLHSQQSQAQGVFVSLYYAWPQRRQFTCLFHPVLFNHGVVALEDGFLDAAELRRLNYRRRELGLPLVRAGLVEVEVGPLVEEPPFSGSLPRALGFLNYQVRAKMGAPAEAGGGWRRSGSTRTRGRAARSTTGRLQRPCCGPRRRAKCCRATPRQRLRARGEPRHTSGSGAFSQGRRPGRVCRLGWACKARSGPARGGPGPSPVRSGLGLSRARGSPGPGPACGGPSRARGGRRRASPANPFGGTYDALLGDRLNQLLDF 0031B4B0E31FCD25 hcfc1_human Host cell factor 1 HCFC1 HCF1 C1 factor VP16 accessory protein VCAF CFF HFC1 protein protein human Homo sapiens Human MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSVPANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVPGSSISVPTAARTQGVPAVLKVTGPQATTGTPLVTMRPASQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSSPQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPVMVSNPATRMLKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKTITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQAGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPGQPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGHSTSASLATPITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQVTLITAPSGVEAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCETHETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSATSTTMTVMATGAPCSAGPLLGPSMAREPGGRSPAFVQLAPLSSKVRLSSPSIKDLPAGRHSHAVSTAAMTRSSVGAGEPRMAPVCESLQGGSPSTTVTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNPPCETHETGTTHTATTATSNGGTGQPEGGQQPPAGRPCETHQTTSTGTTMSVSVGALLPDATSSHRTVESGLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNMSSNQDPPPAASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPPPEELQVSPGPRQQLPPRQLLQSASTALMGESAEVLSASQTPELPAAVDLSSTGEPSSGQESAGSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQATTIPIVLTQQELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTVPSTVALLPSTATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPPPSKAPMKKENQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQAGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADGQ 0B0C581E2454631E o43889-2 Cyclic AMP-responsive element-binding protein 3 CREB3 LZIP Luman Transcription factor LZIP-alpha LZIP Leucine zipper protein protein protein human Homo sapiens Human MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG 82152E496B924EEC hcf-luman-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region Fusion of amino- and carboxyl-terminal regions of HCF fusion protein fusion protein certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain physical association physical association hcf-luman-2 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association luman-hcf-1 3 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction vp16-hcf-1 3 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction