IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. Scientific reports 2017 imex curation Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-glioblastoma Homo sapiens glioblastoma glioblastoma Glioblastoma Glioblastoma is the same as 'Glioblastoma multiforme' (GBM) -is the same as Astrocytoma Grade 4. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Patient-derived glioma initiating cells (GICs) termed TGS-01 (described in 19896441) were used. Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp Accepted 2018-FEB-01 AT 09:45 GMT AT 09:45 GMT by MGT Scientific reports 2017 imex curation The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. Scientific reports 2017 imex curation Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-glioblastoma Homo sapiens glioblastoma glioblastoma Glioblastoma Glioblastoma is the same as 'Glioblastoma multiforme' (GBM) -is the same as Astrocytoma Grade 4. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Patient derived glioma initiating cells (GICs) termed TGS-01 (described in 19896441) were used Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp Accepted 2018-FEB-01 AT 09:45 GMT AT 09:45 GMT by MGT Scientific reports 2017 imex curation The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. Scientific reports 2017 imex curation Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-glioblastoma Homo sapiens glioblastoma glioblastoma Glioblastoma Glioblastoma is the same as 'Glioblastoma multiforme' (GBM) -is the same as Astrocytoma Grade 4. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Patient derived glioma initiating cells (GICs) termed TGS-04 and TGS-05 (described in 19896441) were used. Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp Accepted 2018-FEB-01 AT 09:45 GMT AT 09:45 GMT by MGT Scientific reports 2017 imex curation The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells. Scientific reports 2017 imex curation Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-glioblastoma Homo sapiens glioblastoma glioblastoma Glioblastoma Glioblastoma is the same as 'Glioblastoma multiforme' (GBM) -is the same as Astrocytoma Grade 4. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Hiramatsu H., Kobayashi K., Kobayashi K., Haraguchi T., Ino Y., Todo T., Iba H. Cancer - Interactions investigated in the context of cancer To examine impacts of DPF1 knockdown on this larger SWI/SNF complex, TGS-01 cells expressing shDPF1 were analyzed by PLA. The results indicated that signals detecting the proximal localization of BRG1 and TLX or BRG1 and LSD1 were drastically decreased, whereas those for BRG1 and BAF155 or LSD1 and TLX were unaffected (Fig. 7, Supplementary Fig. S12). email sent to the author for FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a (no answer); primers in Table S1 do not map to any existing nucleotide sequence. Fig.5 C and D, Fig S11 not annotated. Patient-derived glioma initiating cells (GICs) termed TGS-01 (described in 19896441) were used. Interactions involving FLAG-DPF1, FLAG-DPF2 and FLAG-DPF3a have not been added as the species of origin is not stated, the authors did not reply to a request for information and the most of the relevant primers in Table S1 either do not map at all or are not species specific. iba@ims.u-tokyo.ac.jp Accepted 2018-FEB-01 AT 09:45 GMT AT 09:45 GMT by MGT Scientific reports 2017 imex curation kdm1a_human Lysine-specific histone demethylase 1A Flavin-containing amine oxidase domain-containing protein 2 BRAF35-HDAC complex protein BHC110 KDM1A KIAA0601 LSD1 AOF2 KDM1 [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A protein protein human Homo sapiens Human MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM A61CEDE51E4E0C1D hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA smrc1_human SWI/SNF complex subunit SMARCC1 SMARCC1 BAF155 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 SWI/SNF complex 155 kDa subunit BRG1-associated factor 155 protein protein human Homo sapiens Human MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKELTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPPASAAP DIP protein Q92922 original sequence version: 99 EDA6FF5B0472AEA9 nr2e1_human Nuclear receptor subfamily 2 group E member 1 NR2E1 TLX Nuclear receptor TLX Protein tailless homolog protein protein human Homo sapiens Human MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI 39181A42A2FB79C2 rcor2_human REST corepressor 2 RCOR2 protein protein human Homo sapiens Human MPSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAKLDKYIAMAKEKHGYNIEQALGMLLWHKHDVEKSLADLANFTPFPDEWTVEDKVLFEQAFGFHGKCFQRIQQMLPDKLIPSLVKYYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPADPKREPLPSRPLNARPGPGKKEVQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQVQSMKQTNSSLRQALEGGIDPLRPPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPGAPVPMEEARRGAPLPAPALEEDDEVQITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLIRPALAAPRHSARPGPQPPPTLIGTPLEPPAPSL EA9E53BC578B5A2E smca4_human Transcription activator BRG1 SMARCA4 BRG1 SNF2B SNF2L4 ATP-dependent helicase SMARCA4 SNF2-beta BAF190A Mitotic growth and transcription activator Protein BRG-1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 Protein brahma homolog 1 BRG1-associated factor 190A protein protein human Homo sapiens Human MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein P51532 original sequence version: 125 DIP protein P51532 original sequence version: 115 DIP protein P51532 original sequence version: 154 DIP protein P51532 original sequence version: 136 DIP protein P51532-1 original sequence version: 136 ABDA5EDBF10D7D28 tlx-brg1-baf155-1 1 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous association association Fig. 5A, Fig. S7A rcor2-kdm1a-1 1 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 9 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous association association Fig. 5B, Fig. S7B kdm1a-13 1 5 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 9 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous association association Fig. 5B, Fig. S7B nr2e1-smarca4-1 3 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous association association Fig. S8 baf155-lsd1-1 4 5 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 7 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction Fig. 6 tlx-brg1-1 4 10 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction Fig. 6, Fig. S12 baf155-brg1-1 4 7 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction Fig. 6, Fig. S12 lsd1-brg1-1 4 5 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction Fig. 6, Fig. S12 lsd1-tlx-1 4 5 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction Fig. 6, Fig. S12 kdm1a-smarca4-1 2 5 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous colocalization colocalization Fig. S9 nr2e1-smarca4-2 2 10 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 8 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous colocalization colocalization Fig. S9 kdm1a-smarcc1-1 2 5 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 7 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous colocalization colocalization Fig. S9