IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. Stratified squamous epithelium from a normal human tonsil. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Oncogenic Sox2 regulates and cooperates with VRK1 in cell cycle progression and differentiation. Scientific reports 2016 imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. Cancer - Interactions investigated in the context of cancer 2016-05-15: Pedro Lazo Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es Accepted 2016-JUN-16 AT 09:26 BST AT 09:26 BST by MGT imex curation vrk1_human Serine/threonine-protein kinase VRK1 Vaccinia-related kinase 1 VRK1 protein protein human Homo sapiens Human MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK 5640C624BF059949 sox2_human Transcription factor SOX-2 SOX2 protein protein human Homo sapiens Human MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM DIP protein P48431 original sequence version: 127 DIP protein P48431 original sequence version: 117 EFCCAFE3E3A2B67B sox2-vrk1-1 8 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1B sox2-vrk2-2 6 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1D sox2-vrk1-2 5 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp. Fig. 1A sox2-vrk1-3 1 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp. Fig. 1A sox2-vrk1-4 2 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 2A vrk1-sox2-1 2 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig. 2A sox2-vrk1-5 10 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 2A vrk1-sox2-2 10 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig. 2A vrk1-sox2-3 7 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig. 2A sox2-vrk1-6 7 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 2A sox2-vrk1-7 9 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp. Fig. 2A, 2B vrk1-sox2-5 9 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp. Fig. 2A vrk1-sox2-6 3 12 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2C sox2-vrk1-8 4 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 2D