IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. Cancer cell 2016 imex curation Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. kostanin@nvgn.com,dean.li@u2m2.utah.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-mel_202 Homo sapiens uveal melanoma mel_202 Uveal melanoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. kostanin@nvgn.com,dean.li@u2m2.utah.edu Accepted 2016-AUG-18 AT 08:04 BST AT 08:04 BST by ORCHARD Cancer cell 2016 imex curation These are already Direct Interactions, but as before, I am not clear as to what else needs altering, if anything.; I have altered all to "Direct" - but I am not clear if you want anything else altering? (see other experiment-Expt-4) ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. Cancer cell 2016 imex curation Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. kostanin@nvgn.com,dean.li@u2m2.utah.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange tag fluorescence tag visualisation by fluorescence tag fluorescence Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. Replacement of ARF6-bound GDP with GTP-BODIPY was monitored by measuring increases in fluorescence intensity;Intrinsic fluorescence of GTP-BODIPY is intramolecularly quenched in the unbound state but fluorescence is significantly increased upon binding to a target protein such as ARF6. kostanin@nvgn.com,dean.li@u2m2.utah.edu Accepted 2016-AUG-18 AT 08:04 BST AT 08:04 BST by ORCHARD Cancer cell 2016 imex curation These are already Direct Interactions, but as before, I am not clear as to what else needs altering, if anything.; I have altered all to "Direct" - but I am not clear if you want anything else altering? (see other experiment-Expt-4) ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. Cancer cell 2016 imex curation Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. kostanin@nvgn.com,dean.li@u2m2.utah.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-mel_92.1 human Human mel_92.1 Mel92.1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. kostanin@nvgn.com,dean.li@u2m2.utah.edu Accepted 2016-AUG-18 AT 08:04 BST AT 08:04 BST by ORCHARD Cancer cell 2016 imex curation These are already Direct Interactions, but as before, I am not clear as to what else needs altering, if anything.; I have altered all to "Direct" - but I am not clear if you want anything else altering? (see other experiment-Expt-4) ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma. Cancer cell 2016 imex curation Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. kostanin@nvgn.com,dean.li@u2m2.utah.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange tag visualisation tag visualisation Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer I have not included any results from Supp Fig 6 A/B as I would not like to guess at either/or interactors present or exact method(s) used. kostanin@nvgn.com,dean.li@u2m2.utah.edu Accepted 2016-AUG-18 AT 08:04 BST AT 08:04 BST by ORCHARD Cancer cell 2016 imex curation These are already Direct Interactions, but as before, I am not clear as to what else needs altering, if anything.; I have altered all to "Direct" - but I am not clear if you want anything else altering? (see other experiment-Expt-4) arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS DIP protein P62330 original sequence version: 126 DIP protein P62330 original sequence version: 113 DIP protein P62330 original sequence version: 105 49E38E59AEA52B98 nav2729 NAV2729 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 guanosine 5'-[gamma-thio]triphosphate GTP-gamma-S small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gnaq_human Guanine nucleotide-binding protein G(q) subunit alpha GNAQ GAQ Guanine nucleotide-binding protein alpha-q protein protein human Homo sapiens Human MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV DIP protein P50148 original sequence version: 154 6F69C4F617DFA7C7 iqec1_human IQ motif and SEC7 domain-containing protein 1 IQSEC1 ARFGEP100 BRAG2 KIAA0763 ADP-ribosylation factors guanine nucleotide-exchange protein 100 ADP-ribosylation factors guanine nucleotide-exchange protein 2 Brefeldin-resistant Arf-GEF 2 protein protein protein human Homo sapiens Human MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEGKQVSVTNDGSQLGALVSPECGDLSEPTTLKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTEPQTALHGMDHRKLDEMTASYSDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSCRSTPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKHGPHSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESSSRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDSYASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPSVLCS 5B31F9918F9CFF11 cyh2_human Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 ARF nucleotide-binding site opener ARF exchange factor CYTH2 ARNO PSCD2L PSCD2 protein protein human Homo sapiens Human MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP DIP protein Q99418 original sequence version: 131 DIP protein Q99418 original sequence version: 140 DIP protein Q99418-1 original sequence version: 125 DIP protein Q99418 original sequence version: 125 70441A58483BD0E1 245twes-1 1 10 unspecified role unspecified role bait bait P50148:p.Gln209Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 18:30:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln209leu' Tue Jun 30 18:35:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln209Leu' P50148:p.Arg210Lys mutation mutation certain certain sequence position certain certain certain sequence position certain R K Wed May 02 14:49:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg210lys' Tue Jun 30 15:43:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg210Lys' 11 unspecified role unspecified role prey prey physical association physical association 4D gnaq-iqsec1-1 3 10 unspecified role unspecified role bait bait P50148:p.Gln209Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 16:28:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln209leu' Tue Jun 30 19:39:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln209Leu' 11 unspecified role unspecified role prey prey physical association physical association 4D arf6-gdp-1 2 7 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 29 direct interaction direct interaction 6 C/D/E/F arf6-gdp-2 2 6 inhibitor inhibitor neutral component neutral component 7 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 35 38 direct interaction direct interaction 6 C/D/E/F arf6-gdp-3 4 6 inhibitor inhibitor neutral component neutral component 8 cofactor cofactor coenzyme neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 44 47 direct interaction direct interaction 6 C arf6-gdp-4 4 8 cofactor cofactor coenzyme neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 55 52 direct interaction direct interaction 6 C arf6-gdp-5 2 12 ancillary ancillary neutral component neutral component sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 63 66 direct interaction direct interaction 6 D arf6-cyth2-1 2 12 ancillary ancillary neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 inhibitor inhibitor neutral component neutral component 74 77 direct interaction direct interaction 6 Di arf6-cyth2-2 2 11 ancillary ancillary neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region_including_partial_sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 inhibitor inhibitor neutral component neutral component 86 89 direct interaction direct interaction 6 D-2 arf6-cyth2-3 2 11 ancillary ancillary neutral component neutral component region_including_partial_sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 98 101 direct interaction direct interaction 6 D-2i