IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Cancer cell 2016 imex curation Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer fields.alan@mayo.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer parental cells and cells grown as oncospheres fields.alan@mayo.edu Accepted 2016-MAY-12 AT 11:01 BST AT 11:01 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Cancer cell 2016 imex curation Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer fields.alan@mayo.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-h358 Homo sapiens Caucasian bronchioalveolar carcinoma h358 Human Caucasian bronchioalveolar carcinoma Also known as NCI-H358. H358 cells secrete a high level of amphiregulin that, in combination with IGF1, prevents serum deprivation apoptosis. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer H-358 oncospheres fields.alan@mayo.edu Accepted 2016-MAY-12 AT 11:01 BST AT 11:01 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Cancer cell 2016 imex curation Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer fields.alan@mayo.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer A549 oncospheres fields.alan@mayo.edu Accepted 2016-MAY-12 AT 11:01 BST AT 11:01 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Protein Kinase Cι Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma. Cancer cell 2016 imex curation Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer fields.alan@mayo.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay sequence tag sequence tag identification sequence tag Ali SA., Justilien V., Jamieson L., Murray NR., Fields AP. Cancer - Interactions investigated in the context of cancer The main body of the text states that Flag-tagged ELF3 was used. However the Supplementary methods state that N- terminally GST-tagged ELF3 from Abnova was used. As there is no further info w.r.t the Flag-tagged molecule in this paper, nor associated references, the molecule has been annotated as being GST tagged. fields.alan@mayo.edu Accepted 2016-MAY-12 AT 11:01 BST AT 11:01 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation elf3_human ETS-related transcription factor Elf-3 ELF3 ERT ESX JEN E74-like factor 3 Epithelium-specific Ets transcription factor 1 Epithelium-restricted Ets protein ESX Epithelial-restricted with serine box protein protein human Homo sapiens Human MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN 81A23A7DECBE2EF9 kpci_human Protein kinase C iota type nPKC-iota Atypical protein kinase C-lambda/iota PRKCI DXS1179E protein protein human Homo sapiens Human MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV DIP protein P41743 original sequence version: 146 1E3F8C1D4BFC734F notc3_human_gene Neurogenic locus notch homolog protein 3 NOTCH3 gene gene human Homo sapiens Human p78545-1 ETS-related transcription factor Elf-3 E74-like factor 3 Epithelial-restricted with serine box Epithelium-restricted Ets protein ESX Epithelium-specific Ets transcription factor 1 ELF3 ERT ESX JEN ESE-1b protein protein human Homo sapiens Human MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN 81A23A7DECBE2EF9 elf3-notch3-1 1 5 unspecified role unspecified role bait bait P78545:p.Ser68Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S D Wed May 02 17:09:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser68asp' Tue Jun 30 16:16:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser68Asp' P78545:p.Ser68Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:27:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser68ala' Tue Jun 30 18:28:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser68Ala' 7 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4 H/K, 5C There was enhanced ELF3 binding to the NOTCH3 promoter in oncospheres as compared to parental cells. P78545 increases the expression at RNA level of ENSG00000074181 P41743 increases the expression at RNA level of ENSG00000074181 causality from 4J/K/L P41743 increases the binding of P78545 to ENSG00000074181 elf3-prkci-1 4 6 enzyme enzyme neutral component neutral component 8 enzyme target enzyme target substrate substrate neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ser68 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro phosphorylation phosphorylation reaction phosphorylation 5A PKC-iota may have an N-terminal GST or His tag and was expressed either in a strain of S. frugiperda insect cells using a baculovirus expression system. P41743 activates P78545 2345w3r-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp 4A prkci-elf3-1 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp 4A