IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. Cancer cell 2016 imex curation Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer nils.halberg@uib.no,stavazoie@rockefeller.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag visualisation tag visualisation Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer Filter binding assay does not appear to be on the PSI-MI dependencies Table (? was it ever?) so I have assumed immobilised substance is Bait. Amino acid sequence of GST-FAPP-PH domain located from genomic location of stated primers. nils.halberg@uib.no,stavazoie@rockefeller.edu Accepted 2016-MAY-20 AT 13:08 BST AT 13:08 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. Cancer cell 2016 imex curation Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer nils.halberg@uib.no,stavazoie@rockefeller.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro liposome binding assay liposome binding assay weight by staining molecular weight estimation by staining weight by staining Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer "Liposome Pull Down Assay":-Liposomes (phosphatidylcholine, phosphatidylethanolamine and phosphoinositides -ratio 65/24/4) were mixed with PITPNC1. After incubation and centrifugation levels of PITPNC1 in the supernatant and pellet were detected by SDS-PAGE followed by SimplyBlue staining. The liposome bound fraction was determined as PITPNC1 protein levels in the pellet compared to supernatant. nils.halberg@uib.no,stavazoie@rockefeller.edu Accepted 2016-MAY-20 AT 13:08 BST AT 13:08 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. Cancer cell 2016 imex curation Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer nils.halberg@uib.no,stavazoie@rockefeller.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer Flag tag was determined to be C terminal by translating appropriate primer sequences. nils.halberg@uib.no,stavazoie@rockefeller.edu Accepted 2016-MAY-20 AT 13:08 BST AT 13:08 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. Cancer cell 2016 imex curation Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer nils.halberg@uib.no,stavazoie@rockefeller.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer nils.halberg@uib.no,stavazoie@rockefeller.edu Accepted 2016-MAY-20 AT 13:08 BST AT 13:08 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion. Cancer cell 2016 imex curation Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer nils.halberg@uib.no,stavazoie@rockefeller.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer Flag tag was determined to be C terminal by translating appropriate primer sequences. nils.halberg@uib.no,stavazoie@rockefeller.edu Accepted 2016-MAY-20 AT 13:08 BST AT 13:08 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered phosphatidylinositol-3-phosphate phosphatidylinositol 3-phosphate phosphatidylinositol 3-phosphates PI(3)P PtdIns3P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC DIP protein Q9H0U4 original sequence version: 124 DIP protein Q9H0U4 original sequence version: 114 9812FF4DAC34B2BE pkha3_human Pleckstrin homology domain-containing family A member 3 PLEKHA3 FAPP1 Phosphatidylinositol-four-phosphate adapter protein 1 protein protein human Homo sapiens Human MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS 0B6EF45C7D17E82C 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN DIP protein P61981 original sequence version: 126 DIP protein P61981 original sequence version: 135 B0D16C6DE1F4455D 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 phosphatidylinositol 5-phosphate phosphatidylinositol 5-phosphate PI(5)P PtdIns5P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9ukf7-1 Cytoplasmic phosphatidylinositol transfer protein 1 PITPNC1 Mammalian rdgB homolog beta Retinal degeneration B homolog beta sp1 protein protein human Homo sapiens Human MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEAKDVEREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDEVREFERATQEATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCRPKSE D42C8F00FFA54C6A 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 phosphatidylinositol 4-phosphates phosphatidylinositol 4-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 phosphatidylinositol_3_phosphate-pitpnc1-1 1 6 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A-1,Supp fig 2 weaker interaction phosphatidylinositol 4_phosphates-pitpnc1-1 1 17 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A-2, Supp fig 2 phosphatidylinositol_1-pitpnc1-1 1 13 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A-3, Supp fig 2 weaker interaction phosphatidylinositol_1-pitpnc1-2 1 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A-4 weaker interaction phosphatidylinositol 4_phosphates-pitpnc1-2 2 17 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey Q9UKF7-1:p.Asn88Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N F Wed May 02 15:37:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn88phe' Tue Jun 30 18:12:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn88Phe' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9UKF7-1:p.Thr58Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T E Wed May 02 15:33:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr58glu' Tue Jun 30 19:08:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr58Glu' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 B/E pitpnc1-rab1b-1 3 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 3A the 14-3-3 protein - "sigma" does not seem to be listed - but all others in UniProt are. pitpnc1-rab1b-2 5 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 3B the 14-3-3 protein - "sigma" does not seem to be listed - but all others in UniProt are. binding of RAB1b is weak pitpnc1-rab1b-3 5 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9UKF7-1:p.[Ser274Ala;Ser299Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:20:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser274ala,ser299ala' Tue Jun 30 19:08:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser274Ala;Ser299Ala]' physical association physical association 3Bi pitpnc1-rab1b-4 4 9 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 3F The vast majority of the overlap between the two proteins is detected in the perinuclear Golgi region. phosphatidylinositol 4_phosphates-plekha3-1 1 17 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey ph_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp fig 2B