IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Facilitating T Cell Infiltration in Tumor Microenvironment Overcomes Resistance to PD-L1 Blockade. Facilitating T Cell Infiltration in Tumor Microenvironment Overcomes Resistance to PD-L1 Blockade. Cancer cell 2016 imex curation Tang H., Wang Y., Chlewicki LK., Zhang Y., Guo J., Liang W., Wang J., Wang X., Fu YX. Cancer - Interactions investigated in the context of cancer Yang-Xin.Fu@UTSouthwestern.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Tang H., Wang Y., Chlewicki LK., Zhang Y., Guo J., Liang W., Wang J., Wang X., Fu YX. Cancer - Interactions investigated in the context of cancer The Supplementary Methods section states that "human or mouse LT-beta-R-Ig or HVEM-Ig" were used for ELISA; the "Ig" has been confirmed to be the Fc receptor by the authors. Yang-Xin.Fu@UTSouthwestern.edu Accepted 2016-MAY-19 AT 13:32 BST AT 13:32 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Facilitating T Cell Infiltration in Tumor Microenvironment Overcomes Resistance to PD-L1 Blockade. Facilitating T Cell Infiltration in Tumor Microenvironment Overcomes Resistance to PD-L1 Blockade. Cancer cell 2016 imex curation Tang H., Wang Y., Chlewicki LK., Zhang Y., Guo J., Liang W., Wang J., Wang X., Fu YX. Cancer - Interactions investigated in the context of cancer Yang-Xin.Fu@UTSouthwestern.edu 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast yeast display yeast display antibody detection identification by antibody antibody detection Tang H., Wang Y., Chlewicki LK., Zhang Y., Guo J., Liang W., Wang J., Wang X., Fu YX. Cancer - Interactions investigated in the context of cancer there are only 2 examples of Yeast Display on the public web site - and no mention at all in PSI-MI dependancies Table. Flow Cytometry seems to be a standard method for detection for Yeast Display. (there is no mention in the paper of fluorescence or any tags attached to ligands nor fluorescently labeled antibodies - but then there is no specific method I can find. Yang- 2014 (referenced) mentions fluorescently labeled mAbs and Flow cytometry -but not to any mols used here. Binding was analyzed by flow cytometry Yang-Xin.Fu@UTSouthwestern.edu Accepted 2016-MAY-19 AT 13:32 BST AT 13:32 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation tnr3_human Tumor necrosis factor receptor superfamily member 3 LTBR D12S370 TNFCR TNFR3 TNFRSF3 Lymphotoxin-beta receptor Tumor necrosis factor C receptor Tumor necrosis factor receptor 2-related protein Tumor necrosis factor receptor type III protein protein human Homo sapiens Human MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD 624626E6022F656F tnf14_mouse Tumor necrosis factor ligand superfamily member 14 Tnfsf14 Light protein protein mouse Mus musculus Mouse MESVVQPSVFVVDGQTDIPFRRLEQNHRRRRCGTVQVSLALVLLLGAGLATQGWFLLRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV 217874AC71AD6BE3 tnr3_mouse Tumor necrosis factor receptor superfamily member 3 Lymphotoxin-beta receptor Ltbr Tnfcr Tnfrsf3 protein protein mouse Mus musculus Mouse MRLPRASSPCGLAWGPLLLGLSGLLVASQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLLLAILLSLVLFLLFTTVLACAWMRHPSLCRKLGTLLKRHPEGEESPPCPAPRADPHFPDLAEPLLPMSGDLSPSPAGPPTAPSLEEVVLQQQSPLVQARELEAEPGEHGQVAHGANGIHVTGGSVTVTGNIYIYNGPVLGGTRGPGDPPAPPEPPYPTPEEGAPGPSELSTPYQEDGKAWHLAETETLGCQDL DIP protein P50284 original sequence version: 95 29B326A566AEF661 tnr14_human Tumor necrosis factor receptor superfamily member 14 TNFRSF14 HVEA HVEM UNQ329/PRO509 Herpes virus entry mediator A Tumor necrosis factor receptor-like 2 protein protein human Homo sapiens Human MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH DIP protein Q92956 original sequence version: 121 46CE13C2C70242C1 tnf14_human Tumor necrosis factor ligand superfamily member 14 Herpes virus entry mediator ligand UNQ391/PRO726 TNFSF14 HVEML LIGHT protein protein human Homo sapiens Human MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV 49D0B1870F390B39 q71f55_mouse Tnfrsf14 Hvem protein protein mouse Mus musculus Mouse MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGVGIAGFLICTRRHLHTSSVAKELEPFQQEQQENTIRFPVTEVGFAETEEETASN 4A615FB2629E9125 tnfrsf14-tnfsf14-1 1 6 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain DE GK Fri Jul 22 11:01:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 15:12:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 15:46:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 3A-1 tnfrsf14-tnfsf14-2 1 8 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain DE GK Fri Jul 22 10:58:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 19:28:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 15:51:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 3A-2 tnfrsf14-tnfsf14-3 1 7 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain DE GK Fri Jul 22 11:10:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 18:17:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 20:13:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A-3 ltbr-tnfsf14-1 1 5 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain DE GK Fri Jul 22 11:10:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 14:57:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 17:13:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 3A-4 tnfsf14-ltbr-1 2 7 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain DE GK certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G Fri Jul 22 11:00:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 15:51:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 20:14:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' 3 unspecified role unspecified role prey prey physical association physical association 2 A tnfsf14-ltbr-2 2 7 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 2 A tnfsf14-ltbr-3 2 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2 Ai tnfsf14-ltbr-4 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain DE GK certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G Fri Jul 22 11:15:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 18:22:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 18:45:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' physical association physical association 2 A tnfsf14-ltbr-5 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2 Am tnfsf14-tnfrsf14-1 2 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 2 Am tnfsf14-tnfrsf14-2 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain DE GK Tue Jan 24 13:44:13 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 18:55:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 19:05:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' physical association physical association 2 Am tnfsf14-ltbr-6 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain DE GK certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain S G Tue Jan 24 13:46:14 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp221gly,glu222lys' Wed May 02 16:17:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala138thr,ser160gly,asp_glu221-222gly_lys' Tue Jun 30 16:43:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys]' physical association physical association 2 A/B