IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ High-affinity interaction between interleukin-11 and S100P protein. High-affinity interaction between interleukin-11 and S100P protein. Biochemical and biophysical research communications 2015 imex curation Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer Dark Space = 61? permyakov.s@gmail.com Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer Dark Space = 61? Glutaraldehyde as cross linker. permyakov.s@gmail.com Accepted 2017-FEB-20 AT 11:49 GMT AT 11:49 GMT by ORCHARD Biochemical and biophysical research communications 2015 imex curation High-affinity interaction between interleukin-11 and S100P protein. High-affinity interaction between interleukin-11 and S100P protein. Biochemical and biophysical research communications 2015 imex curation Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer Dark Space = 61? permyakov.s@gmail.com Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer Dark Space = 61? permyakov.s@gmail.com Accepted 2017-FEB-20 AT 11:49 GMT AT 11:49 GMT by ORCHARD Biochemical and biophysical research communications 2015 imex curation High-affinity interaction between interleukin-11 and S100P protein. High-affinity interaction between interleukin-11 and S100P protein. Biochemical and biophysical research communications 2015 imex curation Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer Dark Space = 61? permyakov.s@gmail.com Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer Dark Space = 61? permyakov.s@gmail.com Accepted 2017-FEB-20 AT 11:49 GMT AT 11:49 GMT by ORCHARD Biochemical and biophysical research communications 2015 imex curation s100p_human Protein S100-P S100 calcium-binding protein P S100P S100E Protein S100-E Migration-inducing gene 9 protein protein protein human Homo sapiens Human MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK 786E6E3F3EACC6C1 i11ra_human Interleukin-11 receptor subunit alpha IL11RA protein protein human Homo sapiens Human MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAPNL 1F8BC05C139FC326 calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) il11_human Interleukin-11 Adipogenesis inhibitory factor IL11 protein protein human Homo sapiens Human MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL F292BF8B34F4096D il11-s100p-1 3 4 unspecified role unspecified role prey prey n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 stimulator stimulator unspecified role unspecified role direct interaction direct interaction 1 A/B Data fitted a heterogeneous (two) ligand model with one analyte molecule, which generates two Kd values. il11-il11ra-1 3 5 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region_including_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 17 direct interaction direct interaction 1Ai Data fitted a heterogeneous (two) ligand model with one analyte molecule, which generates two Kd values. il11-s100p-2 2 4 unspecified role unspecified role neutral component neutral component n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 stimulator stimulator unspecified role unspecified role direct interaction direct interaction 2A The affinity of S100P to the strongest IL-11 binding site was derived from the 1st stage of the titration curve using the single site binding model. calcium(2+)-il11-1 1 4 unspecified role unspecified role neutral component neutral component n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B Evidence is shown of higher order quaternary structures.