IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-skov_3 Homo sapiens ovarian adenocarcinoma cell line skov_3 Human ovarian adenocarcinoma cell line Derived from the ascitic fluid from a 64 year old caucasian female with an ovarian tumour. Forms moderately well-differentiated adenocarcinoma consistent with ovarian primary cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. Either SKOV3 or SKOV3.ip1 cell line was used here. SKOV3.ip1 line was generated from ascites (metastatic sites) developed in nu/nu mouse from SK-OV-3 cells. This cell line is stated here to be EphrinB2-negative. Cells were treated with recombinant EPO. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-a2780 A2780 Human ovarian cancer cell line Human a2780 A2780-Human ovarian cancer cell line ECACC catalogue no. 93112520 (would appear to be pre-1985 cell line - cannot locate a publication.) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. Cells were treated with recombinant EPO. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. Either SKOV3 or SKOV3.ip1 cell line was used here. SKOV3.ip1 line was generated from ascites (metastatic sites) developed in nu/nu mouse from SK-OV-3 cells. This cell line is stated here to be EphrinB2-negative. Cells were treated with recombinant EPO. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. Competitive binding assay: tubes were coated with EphB4, dilutions of rhEpo-alpha or rhEpo-beta were then mixed with a predetermined concentration of [I125] rhEpo, and radioactivity was measured after 2 hr of incubation. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation Erythropoietin Stimulates Tumor Growth via EphB4. Erythropoietin Stimulates Tumor Growth via EphB4. Cancer cell 2015 imex curation Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK., Pradeep S., Huang J., Mora EM., Nick AM., Cho MS., Wu SY., Noh K., Pecot CV., Rupaimoole R., Stein MA., Brock S., Wen Y., Xiong C., Gharpure K., Hansen JM., Nagaraja AS., Previs RA., Vivas-Mejia P., Han HD., Hu W., Mangala LS., Zand B., Stagg LJ., Ladbury JE., Ozpolat B., Alpay SN., Nishimura M., Stone RL., Matsuo K., Armaiz-Peña GN., Dalton HJ., Danes C., Goodman B., Rodriguez-Aguayo C., Kruger C., Schneider A., Haghpeykar S., Jaladurgam P., Hung MC., Coleman RL., Liu J., Li C., Urbauer D., Lopez-Berestein G., Jackson DB., Sood AK. Cancer - Interactions investigated in the context of cancer The anti-bait IP in Figure 3D cannot be annotated as a non-specific antibody was used. Pdbe has NO entries for crystals for this publication. Suppliers of proteins used are given near end of the Supplement - nice idea, but they do not state which "binding assay" uses which protein. Supp fig 3K; EpoR + EPHB4 - looks positive for coloc to me, but the cells are meant to not express EpoR?? I was going to send the authors a much longer email - but as it took them so long to reply to the initial species/origins question I have not bothered. Cells used were depleted of EpoR. There are errors/discrepancies with regard to the suppliers of proteins (EphB4 and EpoR) used for MST experiments, between the table in the Supplement - "g Chemicals" - and main Methods section;however all proteins listed in Supplementary table "g Chemicals" are of Human origin. [EPHB4 (cat no 10235-HCCH-200) is stated to have been supplied by Sino Biologicals in Methods section, Table in Supplement states "R+D" as supplier and gives Sino Biological Catalogue number. EpoR - similar to the above, only the Supp. Table does give the R+D catalogue numbers.] The authors have stated that all proteins used were of Human origin. asood@mdanderson.org Accepted 2017-AUG-08 AT 11:59 BST AT 11:59 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation epor_human Erythropoietin receptor EPOR protein protein human Homo sapiens Human MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS DIP protein P19235 original sequence version: 168 DIP protein P19235 original sequence version: 186 F9F326E162E9512A stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D efnb2_human Ephrin-B2 EFNB2 EPLG5 HTKL LERK5 EPH-related receptor tyrosine kinase ligand 5 HTK ligand protein protein human Homo sapiens Human MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV DIP protein P52799 original sequence version: 78 DIP protein P52799 original sequence version: 92 mint Binds to the receptor tyrosine kinases EPHB4 and EPHA3. May play a role in constraining the orientation of longitudinally projecting axons 6D9932A632626AEA ephb4_human Ephrin type-B receptor 4 Tyrosine-protein kinase TYRO11 EPHB4 HTK TYRO11 Hepatoma transmembrane kinase MYK1 protein protein human Homo sapiens Human MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGTGGPAPQY 11A004622F194706 chlae_erythropoietin_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey stat3_oligo_consensus_binding_ site oligo with consensus STAT3 binding site ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) p01588-pro_0000008401 Erythropoietin EPO protein protein human Homo sapiens Human APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR 28 193 69ABD636B3543DBD p54760-1 Ephrin type-B receptor 4 Hepatoma transmembrane kinase Tyrosine-protein kinase TYRO11 EPHB4 HTK MYK1 TYRO11 protein protein human Homo sapiens Human MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGTGGPAPQY 11A004622F194706 epo_human Erythropoietin EPO protein protein human Homo sapiens Human MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR C91F0E4C26A52033 epo-epor-3 1 9 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 15 unspecified role unspecified role neutral component neutral component red_NT-647_dye fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 1B ephb4-epo-2 1 16 unspecified role unspecified role neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain red_NT-647_dye fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 15 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 1C ephb2-ephb4-1 1 11 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 16 unspecified role unspecified role neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain red_NT-647_dye fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human direct interaction direct interaction 1D efnb2-ephb4-1 5 11 unspecified role unspecified role neutral component neutral component c_terminus tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind range range range range possible_flag_or_fc_ tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 1 E/Fi, Supp 1D For Fig 1 E/F this is probably a "theoretical" interaction as there is no " zero" conc. of Epo shown. ephb4-epo-3 6 12 unspecified role unspecified role neutral component neutral component P54760:p.[Glu44Ser;Ser46Ala;Leu48Tyr;Glu50Ser;Tyr58Leu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain E S certain certain sequence position certain certain certain sequence position certain L Y certain certain sequence position certain certain certain sequence position certain E S certain certain sequence position certain certain certain sequence position certain Y L Wed May 02 19:07:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu44ser,ser46ala,leu48tyr,glu50ser,tyr58leu' Tue Jun 30 17:41:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu44Ser;Ser46Ala;Leu48Tyr;Glu50Ser;Tyr58Leu]' 13 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2E/F ephb4-epo-4 6 13 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2E/F 24134234-1 8 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey human-a2780 A2780 Human ovarian cancer cell line Human a2780 A2780-Human ovarian cancer cell line ECACC catalogue no. 93112520 (would appear to be pre-1985 cell line - cannot locate a publication.) physical association physical association 3F Erythropoietin epo-epor-4 5 9 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 15 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Supp 1E efnb2-ephb4-2 7 12 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range possible_flag_or_fc_ tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 17 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp 1 M/N ephb4-epo-5 7 17 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range possible_flag_or_fc_ tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 15 competitor competitor competitor prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Supp 1M Epo-alpha is a dimeric, glycosylated, polypeptide chain consisting of two mature human EPO molecules linked to the Fc portion of human IgG1. It has been assumed the "mature" sequence refers to the full length molecule minus the signal sequence -aas 28 – 193, although this is not stated. ephb4-epo-6 7 17 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait possible_flag_or_fc_ tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind range range range range human Homo sapiens Human 17 competitor competitor competitor prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Supp 1Ni EPO-beta is a single, polypeptide chain containing 165 amino acids (sequence numbering unspecified). ephb4-epo-7 3 12 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Supp 3F ephb4-epo-8 2 12 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Supp 3F ephb4-epo-9 4 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Supp 3F efnb2-ephb4-3 5 11 unspecified role unspecified role neutral component neutral component c_terminus tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 15 competitor competitor competitor neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind range range range range possible_flag_or_fc_ tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 1 E/Fi