IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Cancer cell 2015 imex curation Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-pac1 PAC1-Rat pulmonary artery smooth muscle cell line Rat pac1 PAC1-Rat pulmonary artery smooth muscle cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Accepted 2016-JAN-26 AT 11:14 GMT AT 11:14 GMT by ORCHARD Cancer cell 2015 Only protein-protein interactions imex curation imex curation done Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Cancer cell 2015 imex curation Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Accepted 2016-JAN-26 AT 11:14 GMT AT 11:14 GMT by ORCHARD Cancer cell 2015 Only protein-protein interactions imex curation imex curation done Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Cancer cell 2015 imex curation Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Accepted 2016-JAN-26 AT 11:14 GMT AT 11:14 GMT by ORCHARD Cancer cell 2015 Only protein-protein interactions imex curation imex curation done Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Cancer cell 2015 imex curation Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Accepted 2016-JAN-26 AT 11:14 GMT AT 11:14 GMT by ORCHARD Cancer cell 2015 Only protein-protein interactions imex curation imex curation done Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Cancer cell 2015 imex curation Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Accepted 2016-JAN-26 AT 11:14 GMT AT 11:14 GMT by ORCHARD Cancer cell 2015 Only protein-protein interactions imex curation imex curation done Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Cancer cell 2015 imex curation Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. GST- MEK1-deltaN-EE was incubated with His-ERK2 plus increasing concentrations of DEL-22379, or DEL-22379 was added after ERK2 had been phosphorylated. Samples were analyzed by native electrophoresis and immunoblotted both before and after HPLC fractionation. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Accepted 2016-JAN-26 AT 11:14 GMT AT 11:14 GMT by ORCHARD Cancer cell 2015 Only protein-protein interactions imex curation imex curation done Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Small Molecule Inhibition of ERK Dimerization Prevents Tumorigenesis by RAS-ERK Pathway Oncogenes. Cancer cell 2015 imex curation Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Accepted 2016-JAN-26 AT 11:14 GMT AT 11:14 GMT by ORCHARD Cancer cell 2015 Only protein-protein interactions imex curation imex curation done mk01_mouse Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein mouse Mus musculus Mouse MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P63085 original sequence version: 120 DIP protein P63085 original sequence version: 94 DIP protein P63085 original sequence version: 88 DIP protein P63085 original sequence version: 103 DIP protein P63085 original sequence version: 121 DIP protein P63085 original sequence version: 101 3BBCF22471EDBA0B max_human Protein max MAX BHLHD4 Class D basic helix-loop-helix protein 4 Myc-associated factor X protein protein human Homo sapiens Human MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS DIP protein P61244 original sequence version: 132 DIP protein P61244 original sequence version: 128 DIP protein P61244 original sequence version: 150 DIP protein P61244 original sequence version: 120 EB10F3137727A56F mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 del-22379 DEL-22379 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mapk1-mapk1-1 7 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D EGF -epidermal growth factor DEL-22379 (CHEBI:90905) The estimated IC 50 is ~0.5 uM mapk1-mapk1-2 3 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 1E EGF -epidermal growth factor DEL-22379 (CHEBI:90905) mapk1-mapk1-3 6 8 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm P63085:p.[His176Glu;Leu333Ala;Leu336Ala;Leu341Ala;Leu344Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:53:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his176glu,leu333ala,leu336ala,leu341ala,leu344ala' Tue Jun 30 18:23:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His176Glu;Leu333Ala;Leu336Ala;Leu341Ala;Leu344Ala]' ecoli Escherichia coli (strain K12) physical association physical association 1F, 7F, Supp 1A (LHS + RHS), 1F, del_22379-mapk1-1 6 12 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1F, Supp 1 F/G DEL-22379 (CHEBI:90905) DEL-22379 on had no effect pre-existing ERK2 dimers. CHEBI:90905 decreases the dimerisation of P63085 del_22379-mapk1-2 4 12 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component P63085:p.His176Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H L Wed May 02 15:37:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his176leu' Tue Jun 30 17:25:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His176Leu' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P63085:p.Asp175Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:07:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp175ala' Tue Jun 30 17:46:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp175Ala' red_NT_647_dye fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P63085:p.Phe181Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A Wed May 02 17:49:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe181ala' Tue Jun 30 19:07:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe181Ala' ecoli Escherichia coli (strain K12) physical association physical association 2B An ERK2 mutant "F329A" is stated as have been used in this experiment, however there is not an "F" at residue 239, so this mutation has not been entered. mapk1-mapk1-4 7 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7D EGF -epidermal growth factor starvation mapk1-mapk1-5 1 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7D-2 EGF -epidermal growth factor starvation mapk1-1 5 8 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm P63085:p.[His176Glu;Leu333Ala;Leu336Ala;Leu341Ala;Leu344Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:04:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his176glu,leu333ala,leu336ala,leu341ala,leu344ala' Tue Jun 30 15:42:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His176Glu;Leu333Ala;Leu336Ala;Leu341Ala;Leu344Ala]' ecoli Escherichia coli (strain K12) physical association physical association Supp 1A (middle image) mapk1-mapk1-6 2 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Supp 1D EGF -epidermal growth factor DEL-22379 (CHEBI:90905) max-myc-13 3 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 1E