MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Germline mutations in ETV6 are associated with thrombocytopenia, red cell macrocytosis and predisposition to lymphoblastic leukemia. Germline mutations in ETV6 are associated with thrombocytopenia, red cell macrocytosis and predisposition to lymphoblastic leukemia. Nature genetics 2015 imex curation Noetzli L., Lo RW., Lee-Sherick AB., Callaghan M., Noris P., Savoia A., Rajpurkar M., Jones K., Gowan K., Balduini C., Pecci A., Gnan C., De Rocco D., Doubek M., Li L., Lu L., Leung R., Landolt-Marticorena C., Hunger S., Heller P., Gutierrez-Hartmann A., Xiayuan L., Pluthero FG., Rowley JW., Weyrich AS., Kahr WHA., Porter CC., Di Paola J. Cancer - Interactions investigated in the context of cancer Rare diseases - Interactions investigated in the context of Rare genetic disease Jorge.dipaola@ucdenver.edu,chris.porter@ucdenver.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Noetzli L., Lo RW., Lee-Sherick AB., Callaghan M., Noris P., Savoia A., Rajpurkar M., Jones K., Gowan K., Balduini C., Pecci A., Gnan C., De Rocco D., Doubek M., Li L., Lu L., Leung R., Landolt-Marticorena C., Hunger S., Heller P., Gutierrez-Hartmann A., Xiayuan L., Pluthero FG., Rowley JW., Weyrich AS., Kahr WHA., Porter CC., Di Paola J. Cancer - Interactions investigated in the context of cancer Jorge.dipaola@ucdenver.edu,chris.porter@ucdenver.edu Accepted 2021-SEP-11 AT 15:37 BST AT 15:37 BST by KALPANAP Nature genetics 2015 Only protein-protein interactions imex curation imex curation etv6_human Transcription factor ETV6 ETS translocation variant 6 ETS-related protein Tel1 ETV6 TEL TEL1 protein protein human Homo sapiens Human MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELDEQIYQEDEC DEC45682ECADECBB etv6-etv6-1 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P41212:p.Pro214Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P L P41212:p.Arg418Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R G P41212:p.Asn385_Arg418del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain NRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFR . physical association physical association Fig. S5