IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Cancer cell 2015 imex curation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. smkang@emory.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. smkang@emory.edu Accepted 2015-OCT-14 AT 11:23 BST AT 11:23 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation I have added a GO term - GO:0004355 to all reactions with P00367 -GLUD1 as enzyme. I have moved the two GPx assays to Expt-6 leaving all the other ones here.; I am not sure what you are getting at here; the parameters are added for interaction under "experimental conditions". I have added another version of this expt in Expt-7 - but not sure if this is what you were meaning. I have also added one interaction with GTP as an inhibitor as I dont think this is shown elsewhere. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Cancer cell 2015 imex curation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. smkang@emory.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. GPX Assay:-A kit from Biovision was used. GPx1 reduces Cumene Hydroperoxide while oxidizing GSH to GSSG. The generated GSSG is reduced to GSH with consumption of NADPH by GR. This decrease of NADPH is measured at 340 nm and is proportional to GPx1 activity. The authors state that all the constructs used are of human origin. smkang@emory.edu Accepted 2015-OCT-14 AT 11:23 BST AT 11:23 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation I have added a GO term - GO:0004355 to all reactions with P00367 -GLUD1 as enzyme. I have moved the two GPx assays to Expt-6 leaving all the other ones here.; I am not sure what you are getting at here; the parameters are added for interaction under "experimental conditions". I have added another version of this expt in Expt-7 - but not sure if this is what you were meaning. I have also added one interaction with GTP as an inhibitor as I dont think this is shown elsewhere. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Cancer cell 2015 imex curation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. smkang@emory.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. GDH1 Activity Assay: activity was assessed by monitoring the oxidation of NADPH as a decrease in absorbance at 340 nm after the addition of the (reverse reaction) substrate alpha-KGA. 6PGD enzyme activity was directly determined by measuring the rate of NADPH production. FH activity was determined by measuring the rate of NADPH production by a coupled reaction. The authors state that all the constructs used are of human origin. smkang@emory.edu Accepted 2015-OCT-14 AT 11:23 BST AT 11:23 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation I have added a GO term - GO:0004355 to all reactions with P00367 -GLUD1 as enzyme. I have moved the two GPx assays to Expt-6 leaving all the other ones here.; I am not sure what you are getting at here; the parameters are added for interaction under "experimental conditions". I have added another version of this expt in Expt-7 - but not sure if this is what you were meaning. I have also added one interaction with GTP as an inhibitor as I dont think this is shown elsewhere. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Cancer cell 2015 imex curation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. smkang@emory.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Purpurin molar molar M M 0uM 2uM 5uM R162 molar molar M M 10uM 20uM 0uM EGCG molar molar M M 0uM 10uM 20uM No inhibitor molar molar M M 0 Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. EC50 determination in presence of varying concentrations of the allosteric activator ADP, and different amounts of Small Molecule Inhibitors. The GDH1 Activity Assay was used: activity was assessed by monitoring the oxidation of NADPH as a decrease in absorbance at 340 nm after the addition of the (reverse reaction) substrate alpha-KGA. The authors state that all the constructs used are of human origin. smkang@emory.edu Accepted 2015-OCT-14 AT 11:23 BST AT 11:23 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation I have added a GO term - GO:0004355 to all reactions with P00367 -GLUD1 as enzyme. I have moved the two GPx assays to Expt-6 leaving all the other ones here.; I am not sure what you are getting at here; the parameters are added for interaction under "experimental conditions". I have added another version of this expt in Expt-7 - but not sure if this is what you were meaning. I have also added one interaction with GTP as an inhibitor as I dont think this is shown elsewhere. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Cancer cell 2015 imex curation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. smkang@emory.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. 6PGD enzyme activity was directly determined by measuring the rate of NADPH production. The authors state that all the constructs used are of human origin. smkang@emory.edu Accepted 2015-OCT-14 AT 11:23 BST AT 11:23 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation I have added a GO term - GO:0004355 to all reactions with P00367 -GLUD1 as enzyme. I have moved the two GPx assays to Expt-6 leaving all the other ones here.; I am not sure what you are getting at here; the parameters are added for interaction under "experimental conditions". I have added another version of this expt in Expt-7 - but not sure if this is what you were meaning. I have also added one interaction with GTP as an inhibitor as I dont think this is shown elsewhere. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Cancer cell 2015 imex curation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. smkang@emory.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down tag visualisation tag visualisation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. smkang@emory.edu Accepted 2015-OCT-14 AT 11:23 BST AT 11:23 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation I have added a GO term - GO:0004355 to all reactions with P00367 -GLUD1 as enzyme. I have moved the two GPx assays to Expt-6 leaving all the other ones here.; I am not sure what you are getting at here; the parameters are added for interaction under "experimental conditions". I have added another version of this expt in Expt-7 - but not sure if this is what you were meaning. I have also added one interaction with GTP as an inhibitor as I dont think this is shown elsewhere. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Glutamate dehydrogenase 1 signals through antioxidant glutathione peroxidase 1 to regulate redox homeostasis and tumor growth. Cancer cell 2015 imex curation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. smkang@emory.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro thermal shift thermal shift binding thermal shift predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer Email sent 28/5/15 Watch out for Summary View for Ki values; bug makes them look like e.g. " ki: 2.100000000000000088817841970012523233890533447265625x10^-6 molar". I have removed all decimal points to remove the extraneous figures. The authors state that all the constructs used are of human origin. smkang@emory.edu Accepted 2015-OCT-14 AT 11:23 BST AT 11:23 BST by PPORRAS Cancer cell 2015 Only protein-protein interactions imex curation imex curation I have added a GO term - GO:0004355 to all reactions with P00367 -GLUD1 as enzyme. I have moved the two GPx assays to Expt-6 leaving all the other ones here.; I am not sure what you are getting at here; the parameters are added for interaction under "experimental conditions". I have added another version of this expt in Expt-7 - but not sure if this is what you were meaning. I have also added one interaction with GTP as an inhibitor as I dont think this is shown elsewhere. glutathione glutathione gamma-L-Glutamyl-L-cysteinyl-glycine 5-L-Glutamyl-L-cysteinylglycine Glutathione Glutathione-SH GSH N-(N-gamma-L-Glutamyl-L-cysteinyl)glycine Reduced glutathione L-gamma-glutamyl-L-cysteinylglycine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) adp adenosine 5'-(trihydrogen diphosphate) (ADP) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) a-kg alpha-ketoglutarate OR 2-OXOGLUTARIC ACID small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 6pgd_human 6-phosphogluconate dehydrogenase, decarboxylating PGD PGDH protein protein human Homo sapiens Human MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA 6CEFC0077D1283E3 gpx1_human Glutathione peroxidase 1 GPX1 Cellular glutathione peroxidase protein protein human Homo sapiens Human MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA mint homomint Protects the hemoglobin in erythrocytes from oxidative breakdown 5DB11579C66FE8E5 dhe3_human Glutamate dehydrogenase 1, mitochondrial GLUD1 GLUD protein protein human Homo sapiens Human MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADREDDPNFFKMVEGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT A7319A840F57FBB2 6-phospho-d-gluconic acid 6-phospho-D-gluconic acid 6-Phospho-D-gluconate 6-O-phosphono-D-gluconic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) purpurin purpurin 1,2,4-trihydroxy-9,10-anthracenedione 1,2,4-trihydroxy-9,10-anthraquinone 1,2,4-trihydroxyanthra-9,10-quinone 1,2,4-Trihydroxyanthrachinon 1,2,4-trihydroxyanthraquinone C.I. 58205 hydroxylizaric acid Pr Purpurin purpurine smoke Brown G verantin 1,2,4-trihydroxyanthracene-9,10-dione small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) (-)-epigallocatechin 3-gallate (-)-epigallocatechin 3-gallate (-)-epigallocatechin-3-O-gallate [(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl] 3,4,5-trihydroxybenzoate EGCG Epigallocatechin 3-gallate (2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fumh_human Fumarate hydratase, mitochondrial FH protein protein human Homo sapiens Human MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK DIP protein P07954 original sequence version: 183 86F91F95DC046F64 r162 R162 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fumaric acid fumaric acid (2E)-2-butenedioic acid (E)-2-butenedioic acid E297 Fumaric acid FUMARIC ACID Fumarsaeure trans-1,2-ethylenedicarboxylic acid trans-but-2-enedioic acid trans-Butenedioic acid (2E)-but-2-enedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fumaric acid-gpx1-1 16 23 unspecified role unspecified role bait bait P07203:p.Thr145_Asp146delinsAlaAla mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain TD AA Wed May 02 15:16:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr_asp145-146ala_ala' Tue Jun 30 19:53:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr145_Asp146delinsAlaAla' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 30 unspecified role unspecified role prey prey region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 5D, Supp 4C/E a_kg-glud1-1 3 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction 6B a_kg-glud1-2 3 26 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction 6B-1, Supp 5C/5F+H,I a_kg-glud1-3 3 29 unspecified role unspecified role unspecified role unspecified role 20 unspecified role unspecified role unspecified role unspecified role 24 unspecified role unspecified role unspecified role unspecified role redox reaction oxidoreductase activity electron transfer reaction redox reaction 6B, 6G, supp 5F/I R162 acts as a mixed model inhibitor a_kg-glud1-4 1 29 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC direct interaction direct interaction 6C a_kg-glud1-5 1 26 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC direct interaction direct interaction 6C glud1-r162-1 17 29 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC direct interaction direct interaction 6F a_kg-glud1-6 3 27 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction Supp 5C/5I weak inhibition shown only. 6_phospho_d_gluconic acid-pgd-1 15 27 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 25 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 22 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction supp 5H (_)_epigallocatechin 3_gallate-fh-1 3 27 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 30 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 28 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction supp 5H-2 (_)_epigallocatechin 3_gallate-6_phospho_d_gluconic acid-1 15 25 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 22 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction supp 5Hi (_)_epigallocatechin 3_gallate-fh-2 3 30 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 28 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction supp 5H-2i glutathione-gpx1-3 2 23 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC 18 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) redox reaction oxidoreductase activity electron transfer reaction redox reaction 5B (lower) fumarate glutathione-gpx1-4 2 23 enzyme enzyme neutral component neutral component P07203:p.Thr145_Asp146delinsAlaAla mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain TD AA Wed May 02 16:47:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr_asp145-146ala_ala' Tue Jun 30 16:47:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr145_Asp146delinsAlaAla' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 18 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) redox reaction oxidoreductase activity electron transfer reaction redox reaction 5B (upper), 5E fumarate (_)_epigallocatechin 3_gallate-a_kg-2 4 19 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction Supp 5J EC50 for this interaction was calculated using the average of the three no-inhibitor values used in figure S5J. a_kg-adp-3 4 19 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 26 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction 6 Supp 5J-2 a_kg-adp-4 4 19 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 26 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction 7 Supp 5J-3 a_kg-adp-5 4 19 stimulator stimulator neutral component neutral component 29 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction 8 Supp 5J-5 a_kg-adp-6 4 19 stimulator stimulator neutral component neutral component 29 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction Supp 5J-6 (_)_epigallocatechin 3_gallate-a_kg-3 4 19 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 27 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction 12 Supp 5J-8 (_)_epigallocatechin 3_gallate-a_kg-4 4 19 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 27 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction 13 Supp 5J-9 (_)_epigallocatechin 3_gallate-a_kg-5 4 21 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 24 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction Supp 5J