IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Cancer Cell (1535-6108) 2014 imex curation Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu Accepted 2015-FEB-02 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Cancer Cell (1535-6108) 2014 imex curation Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu Accepted 2015-FEB-02 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Cancer Cell (1535-6108) 2014 imex curation Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. No cell line has been stated for Figure 2D; it has been entered here (as 293E) as no other cell line appears to be used in Figure 1. Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. Fig 1: none of the quoted refs for Fig 2E bear much/any relationship to the mutants they should refer to...Gomez one is of some use. zhengst@cinj.rutgers.edu Accepted 2015-FEB-02 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Cancer Cell (1535-6108) 2014 imex curation Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu Accepted 2015-FEB-02 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Cancer Cell (1535-6108) 2014 imex curation Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Thomas J.D., Zhang Y.J., Wei Y.H., Cho J.H., Morris L.E., Wang H.Y., Zheng X.F. Affinomics - Interactions curated for the Affinomics consortium. Interactions using the antibody "P-S6K1(T398)" have not been annotated as this antibody has more than one target. Interactions involving "Myc-mTOR" have not been included as the species of mTOR is not given, and the authors have not replied to a request for information. zhengst@cinj.rutgers.edu Accepted 2015-FEB-02 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation mtor_human Serine/threonine-protein kinase mTOR MTOR FRAP FRAP2 FK506-binding protein 12-rapamycin complex-associated protein 1 Rapamycin target protein 1 FRAP1 Mammalian target of rapamycin FKBP12-rapamycin complex-associated protein Mechanistic target of rapamycin RAFT1 RAPT1 Rapamycin and FKBP12 target 1 protein protein human Homo sapiens Human MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW DIP protein P42345 original sequence version: 158 DIP protein P42345 original sequence version: 82 DIP protein P42345 original sequence version: 108 DIP protein P42345 original sequence version: 107 DIP protein P42345 original sequence version: 138 DIP protein P42345 original sequence version: 168 DIP protein P42345 original sequence version: 173 DIP protein P42345 original sequence version: 120 DIP protein P42345 original sequence version: 149 DIP protein P42345 original sequence version: 134 DIP protein P42345 original sequence version: 148 DIP protein P42345 original sequence version: 118 7D9AD6E784882AB4 rptor_human Regulatory-associated protein of mTOR p150 target of rapamycin (TOR)-scaffold protein RPTOR KIAA1303 RAPTOR protein protein human Homo sapiens Human MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR DIP protein Q8N122 original sequence version: 79 DIP protein Q8N122 original sequence version: 129 DIP protein Q8N122 original sequence version: 138 DIP protein Q8N122 original sequence version: 142 DIP protein Q8N122 original sequence version: 91 DIP protein Q8N122 original sequence version: 118 DIP protein Q8N122-1 original sequence version: 89 DIP protein Q8N122 original sequence version: 128 688ED1943F45045A rictr_human Rapamycin-insensitive companion of mTOR RICTOR KIAA1999 AVO3 homolog protein protein human Homo sapiens Human MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQERDRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEALLSVDPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQKAIATHQKRDQYLRVQKDIFILKDTEEALLINLRDSQVLQHKENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQLTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGMKPERSLQNNGLLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRGTCVYVLGLIAKTKQGCDILKCHNWDAVRHSRKHLWPVVPDDVEQLCNELSSIPSTLSLNSESTSSRHNSESESVPSSMFILEDDRFGSSSTSTFFLDINEDTEPTFYDRSGPIKDKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVDFNHSDDFTPISTVQKTLQLETSFMGNKHIEDTGSTPSIGENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVSTKTIKTSHYLTPQSNHLSLSKSNSVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFSYTSSRDAFGYATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRFMKALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVKDIPYFQTKNIPPHDDRGARAFAHDAGGLPSGTGGLVKNSFHLLRQQMSLTEIMNSIHSDASLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQLSAICSHSDFQDIPYSDWCEQTIHNPLEVVPSKFSGISGCSDGVSQEGSASSTKSTELLLGVKTIPDDTPMCRILLRKEVLRLVINLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDVQFLQMHEEAEAVLATPPKQPIVDTSAES DIP protein Q6R327 original sequence version: 116 DIP protein Q6R327 original sequence version: 81 DIP protein Q6R327 original sequence version: 93 DB7B1E4A45DAE2AB ypt1_yeast GTP-binding protein YPT1 YFL038C YPT1 YP2 Rab GTPase YPT1 Transport GTPase YPT1 Protein YP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC F8C704F6BF2D227B F8C704F6BF2D227B rap2a_human Ras-related protein Rap-2a RbBP-30 RAP2A protein protein human Homo sapiens Human MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ 047D49762765F0B7 rab1a_human Ras-related protein Rab-1A YPT1-related protein RAB1A RAB1 protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC B2A8F4E3B0FB17D6 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 rheb_human GTP-binding protein Rheb Ras homolog enriched in brain RHEB RHEB2 protein protein human Homo sapiens Human MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM DIP protein Q15382 original sequence version: 146 DIP protein Q15382 original sequence version: 91 8F4C8080BDF928FD rragc_human Ras-related GTP-binding protein C GTPase-interacting protein 2 TIB929 RRAGC protein protein human Homo sapiens Human MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI DIP protein Q9HB90 original sequence version: 120 DIP protein Q9HB90 original sequence version: 109 35B3171253CC69CF rab1a-mtor-1 3 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association 2D mtor-rab1a-1 3 11 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey P62820:p.Ser25Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:11:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser25asn' Tue Jun 30 19:46:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser25Asn' P62820:p.Cys204_Cys205delinsSerSer mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain CC SS Thu Jul 07 12:18:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys204,205ser Fri Jul 22 10:49:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys204ser,cys205ser' Wed May 02 17:32:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_cys204-205ser_ser' Tue Jun 30 19:56:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys204_Cys205delinsSerSer' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P62820:p.Gln70Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 20:08:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 18:42:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association 2E The Rab1A C2S mutant is stated to have a C202-203Ser mutation, but the C terminal Cysteines are at residues numbered 204-205 in the human protein. gtp-rab1a-2 1 11 unspecified role unspecified role prey prey human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 12 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 2G/J serum, amino acids gtp-rab1a-3 1 10 unspecified role unspecified role prey prey human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 12 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 2G/J amino acids, serum rab1a-rptor 4 7 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3C, Supp 3G rab1a-rptor-1 4 7 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3D/E/G, Supp 3D Rab1A siRNA disturbs localisation of this complex. gtp-rap2a 1 12 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) physical association physical association Supp 1C amino acids rab1a-mtor-2 2 11 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association Supp 2A rab1a-mtor-3 2 11 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey physical association physical association Supp 2A rab1a-rptor-2 2 8 unspecified role unspecified role prey prey 11 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 2A mtor-rab1a-3 5 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 2B/D rab1a-rptor-3 4 6 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 3H rheb-rptor 4 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 3N/P rptor-rragc 4 6 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 3O/Q mtor-rab1a-4 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2E-1