IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. Cancer Cell (1535-6108) 2014 imex curation Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu Accepted 2015-AUG-06 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Originally I had not annotated the S2J/K/L figures as there were not species for TRCP (or FBXL14-V5)! (see comment at publication level). However after extensive searching - Pagano seems to work with Human - and I found a 1999 ref with his name and FLAG-TRCP (Human). After even more extensive searching I found the FBXL14 construct supplier is mentioned in the Supplement..- so have entered Fig S2 J/K/L. If you think this is OK please can you delete my comment about not being able to enter these figures... [Supp Figure 2J - is in a new Expt - no 5; S2K to Expt 4, Supp 2L to NEW Expt 6. PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. Cancer Cell (1535-6108) 2014 imex curation Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The highly metastatic LM2 subline of MDA-MB-231 (PMID: 16049480) The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu Accepted 2015-AUG-06 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. Cancer Cell (1535-6108) 2014 imex curation Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu Accepted 2015-AUG-06 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Originally I had not annotated the S2J/K/L figures as there were not species for TRCP (or FBXL14-V5)! (see comment at publication level). However after extensive searching - Pagano seems to work with Human - and I found a 1999 ref with his name and FLAG-TRCP (Human). After even more extensive searching I found the FBXL14 construct supplier is mentioned in the Supplement..- so have entered Fig S2 J/K/L. If you think this is OK please can you delete my comment about not being able to enter these figures... [Supp Figure 2J - is in a new Expt - no 5; S2K to Expt 4, Supp 2L to NEW Expt 6. PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. PKD1 Phosphorylation-Dependent Degradation of SNAIL by SCF-FBXO11 Regulates Epithelial-Mesenchymal Transition and Metastasis. Cancer Cell (1535-6108) 2014 imex curation Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zheng H., Shen M., Zha Y.L., Li W., Wei Y., Blanco M.A., Ren G., Zhou T., Storz P., Wang H.Y., Kang Y. Cancer - Interactions investigated in the context of cancer The origin of the Flag-Snail construct has been entered as Human (as found in Ref B.P. Zhou -2004 -see PMID:15448698). The origins of FLAG tagged FBXO11, FBXO1, FBXO5, FBXO10, FBXO31, FBXW1, and FBXW9 - gifts from Dr. M. Pagano, has not been possible to determine; thus results from Supplementary Figures 2J/L have not been entered. ykang@princeton.edu Accepted 2015-AUG-06 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Originally I had not annotated the S2J/K/L figures as there were not species for TRCP (or FBXL14-V5)! (see comment at publication level). However after extensive searching - Pagano seems to work with Human - and I found a 1999 ref with his name and FLAG-TRCP (Human). After even more extensive searching I found the FBXL14 construct supplier is mentioned in the Supplement..- so have entered Fig S2 J/K/L. If you think this is OK please can you delete my comment about not being able to enter these figures... [Supp Figure 2J - is in a new Expt - no 5; S2K to Expt 4, Supp 2L to NEW Expt 6. trim5_human Tripartite motif-containing protein 5 TRIM5 RNF88 RING finger protein 88 RING-type E3 ubiquitin transferase TRIM5 protein protein human Homo sapiens Human MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHTPSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS 8E61AAFD508AF6C0 fxl14_human F-box/LRR-repeat protein 14 FBXL14 F-box and leucine-rich repeat protein 14 FBL14 protein protein human Homo sapiens Human METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR 5779961C8177779F spsb1_human SPRY domain-containing SOCS box protein 1 SSB1 SPSB1 protein protein human Homo sapiens Human MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ F93D5690A32403DF fbx11_human F-box only protein 11 Vitiligo-associated protein 1 FBXO11 FBX11 VIT1 PRMT9 Protein arginine N-methyltransferase 9 UG063H01 protein protein human Homo sapiens Human MNSVRAANRRPRRVSRPRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQERNNVGERDDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTTENFGHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKESFQQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQEAHFDGLIFVHSGIYTDEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNPDDKSAQHHNAHHCLEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYITDHAQGIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN DIP protein Q86XK2 original sequence version: 98 DIP protein Q86XK2 original sequence version: 82 CADBD23A6B892A78 socs3_human Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 STAT-induced STAT inhibitor 3 SOCS3 CIS3 SSI3 protein protein human Homo sapiens Human MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL 08581DC411EFFF19 snai1_human Zinc finger protein SNAI1 Protein snail homolog 1 SNAI1 SNAH protein protein human Homo sapiens Human MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR DIP protein O95863 original sequence version: 109 DIP protein O95863 original sequence version: 141 70E298C9BB154115 fbxo11-snai1-6 2 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 2B fbxo11-snai1-1 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 7E knockdown of "PKD1" -Protein Kinase D1. fbxo11-snai1-2 3 8 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined snag_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1Ii, 6C snai1-fbxo11-1 3 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1Iii snai1-socs3-1 3 7 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1Iiii snai1-spsb1-1 3 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1Iiv trim5-snai1-2 3 5 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1Hiv fbxo11-snai1-3 3 8 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1Hi socs3-snai1-2 3 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1Hii spsb1-snai1-2 3 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1HIiii spsb1-snai1-1 4 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 1J trim5-snai1-1 4 5 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey physical association physical association Supp 1J fbxo11-snai1-4 4 8 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey physical association physical association Supp 1J, 6A alkaline phosphatase (calf intestinal phosphatase [CIP]) socs3-snai1-1 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 1J fbxo11-snai1-5 4 8 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey O95863:p.Leu6Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:53:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu6ala' Tue Jun 30 16:54:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu6Ala' O95863:p.Ser11Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S E Wed May 02 16:54:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser11glu' Tue Jun 30 18:18:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser11Glu' O95863:p.Ser11Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S V Wed May 02 18:42:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser11val' Tue Jun 30 17:41:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser11Val' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O95863:p.Arg8Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:58:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg8ala' Tue Jun 30 20:19:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg8Ala' O95863:p.Ser11Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:05:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser11ala' Tue Jun 30 17:33:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser11Ala' physical association physical association 6D, 7B, supp 6B/D The PKD1 (protein kinase D1) inhibitor CID755673, as well as the dominant-negative PKD1-KW mutant, disrupted the interaction between SNAIL and FBXO11 protein. Co-Ip experiments using several SNAIL mutants, (including the 6SA mutant, which can no longer be phosphorylated by GSK-3beta) did not disrupt the interaction between SNAIL and FBXO11 protein. snai1-fbxl14 4 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 7G C3 Transferase -a RhoA inhibitor snai1-fbxo11-3 3 6 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 2K