IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Cancer Cell (1535-6108) 2014 imex curation Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. caoxt@immunol.org 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. Samples were dotted onto nitrocellulose membranes and autoradiographed. caoxt@immunol.org Accepted 2014-AUG-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Cancer Cell (1535-6108) 2014 imex curation Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. caoxt@immunol.org 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase autoradiography autoradiography Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. The extent of GTP hydrolysis was assessed by measuring the remaining radioactivity- for GTP-bound protein. caoxt@immunol.org Accepted 2014-AUG-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Cancer Cell (1535-6108) 2014 imex curation Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. caoxt@immunol.org 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. caoxt@immunol.org Accepted 2014-AUG-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Small GTPase RBJ Mediates Nuclear Entrapment of MEK1/MEK2 in Tumor Progression. Cancer Cell (1535-6108) 2014 imex curation Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. caoxt@immunol.org 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down tag visualisation tag visualisation Chen T., Yang M., Yu Z., Tang S., Wang C., Zhu X., Guo J., Li N., Zhang W., Hou J., Liu H., Han C., Liu Q., Gu Y., Qian C., Wan T., Cui L., Zhu M., Zheng W., Cao X. Cancer - Interactions investigated in the context of cancer Results obtained using the anti-ERK1/2 and MEK1/2 antibody have not been included due to lack of antibody specificity - as in Figure 4. The origins of HA/GST-RBJ and mutants, GST-KRAS,GST-Rab5A and Recombinant HSC70 cannot be found, and the authors did not reply to a request for info. The quoted 'Wang et al., 2009 reference does not mention these constructs;as a consequence results from several figures cannot be included e.g.Figures 4, 6, Supp. Figure 2. this would appear to be exactly the same as Fig 2A - except for counting method (waste of time?) Samples were prepared for scintillation counting. caoxt@immunol.org Accepted 2014-AUG-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation mk01_mouse Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein mouse Mus musculus Mouse MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P63085 original sequence version: 120 DIP protein P63085 original sequence version: 94 DIP protein P63085 original sequence version: 88 DIP protein P63085 original sequence version: 103 DIP protein P63085 original sequence version: 121 DIP protein P63085 original sequence version: 101 3BBCF22471EDBA0B gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 rask_human GTPase KRas KRAS RASK2 KRAS2 K-Ras 2 Ki-Ras c-K-ras c-Ki-ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 973547B2E11C2C81 guanosine 5'-[gamma-thio]triphosphate GTP-gamma-S small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) djc27_mouse DnaJ homolog subfamily C member 27 Dnajc27 Rabj Rbj Rab and DnaJ domain-containing protein protein protein mouse Mus musculus Mouse METNVPKRKEPAKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYLSIVDLCENGGKRPTASSSASFTKEQADTIRRIRNSKDSWEMLGVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK 805523789CECC329 mp2k1_mouse Dual specificity mitogen-activated protein kinase kinase 1 Map2k1 Mek1 Prkmk1 ERK activator kinase 1 MAPK/ERK kinase 1 protein protein mouse Mus musculus Mouse MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI 01D1D18572AE40E7 dnajc27-gtp 1 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range small_gtp_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:21:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 19:45:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A dnajc27-gdp 1 6 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 16:33:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 19:55:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2Ai dnajc27-gdp-1 1 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 17:51:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 16:53:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' ecoli Escherichia coli (strain K12) 9 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2Aii dnajc27-gtp-2 2 10 enzyme enzyme neutral component neutral component Q8CFP6:p.His75Leu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain H L Wed May 02 18:18:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his75leu' Tue Jun 30 17:43:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His75Leu' Q8CFP6:p.His75Gln mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain H Q Wed May 02 18:12:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his75gln' Tue Jun 30 19:53:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His75Gln' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) gtpase reaction gtpase reaction 2B, Supp. 2D dnajc27-gtp-3 3 11 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range small_gtp_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8CFP6:p.Ser30Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:52:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 18:51:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B/F dnajc27-map2k1 3 10 unspecified role unspecified role bait bait n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B/F,6H dnajc27-gtp-4 1 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range small_gtp_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 16:38:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 18:19:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' ecoli Escherichia coli (strain K12) 7 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2A... dnajc27-gdp-2 3 11 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait small_gtp_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8CFP6:p.Ser30Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Wed May 02 17:26:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 18:06:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4F In the presence of excessive GDP the interaction was reduced. The authors conclude that RBJ interacted with MEK1 in its GTP-bound status. not sure what the Role of GDP should be here - not a competitor as we do not know GDP is competing for binding with MEK for RBJ....(not an antagonist as this is a purified system) dnajc27-map2k1-2 3 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 competitor competitor competitor prey prey nes_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 6H dnajc27-gdp-3 4 9 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 18:15:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 19:21:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. 2C dnajc27-gdp-3 4 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 16:32:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 20:13:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' ecoli Escherichia coli (strain K12) 6 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. 2C dnajc27-gtp-5 4 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 14:41:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 16:57:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' small_gtp_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp 2C dnajc27-gtp-5 4 10 unspecified role unspecified role bait bait Q8CFP6:p.Ser30Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 16:11:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30asn' Tue Jun 30 16:49:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30Asn' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range small_gtp_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp 2C dnajc27-gtp-6 2 8 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) gtpase reaction gtpase reaction Supp. 2D