IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-sum1315 Human 1315- metastatic/invasive breast ductal carcinoma cell line sum1315 Human SUM1315- metastatic/invasive breast ductal carcinoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro acetylase assay acetylase assay western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro acetylase assay acetylase assay sequence tag sequence tag identification sequence tag Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-sum1315 Human 1315- metastatic/invasive breast ductal carcinoma cell line sum1315 Human SUM1315- metastatic/invasive breast ductal carcinoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. Cancer Cell (1535-6108) 2014 imex curation Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-bt_549 Homo sapiens BT_549 Breast ductal carcinoma cell line bt_549 BT 549 Human Breast ductal carcinoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer The exact Twist antibody used is not specified - there are ~5 of them (Santa Cruz Biotechnology) and ALL are non-specific- the Immunogen sequence has substantial homology between TWIST1 and TWIST2 - 66%/96% with 2 of them - the others are targetted to a N or C terminal sequence (unspecified) - sequences are identical/similar for both these proteins at both terminii. Mol. Wts of Twist 1 and 2 are 21 + 18 kDa - so hardly distinguishable..[I assume they mean Twist1 - as the expression is over a much larger tissue range than Twist2, but for cell lines ???] Fluoresce Anisotropy: these should be Competion assays - but I can see No protein being competed against for Fig 1I - presumably Twist1 peptide is meant to be present. The assay protocol was probably taken from Zhang - 2012 - but looks like they have omitted to copy the protocol over to this paper. (supp 4B does not even bother to state it is Flu. Anisotropy - had to find this in the body of the paper.) Basically I have not curated anything IPing endogenous Twist and missed out most of the the FLu. Anisotropy expts. (anything else is a mistake/omission). HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Accepted 2015-FEB-02 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation o60885-1 Bromodomain-containing protein 4 Brd4L Long BRD4 HUNK1 Protein HUNK1 protein protein human Homo sapiens Human MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF DIP protein O60885-1 original sequence version: 72 D52EFE1CF9960907 h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 brd4_human Bromodomain-containing protein 4 Protein HUNK1 BRD4 HUNK1 protein protein human Homo sapiens Human MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF D52EFE1CF9960907 twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH DIP protein Q15672 original sequence version: 156 DIP protein Q15672 original sequence version: 159 9394E4351BA1D081 wnt5a_human_gene WNT5A_HUMAN_GENE gene gene human Homo sapiens Human kat5_human Histone acetyltransferase KAT5 KAT5 TIP60 HTATIP Lysine acetyltransferase 5 cPLA(2)-interacting protein Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein human Homo sapiens Human MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW DIP protein Q92993 original sequence version: 153 DIP protein Q92993 original sequence version: 155 DIP protein Q92993 original sequence version: 86 DIP protein Q92993 original sequence version: 149 DIP protein Q92993-1 original sequence version: 129 DIP protein Q92993 original sequence version: 144 DIP protein Q92993 original sequence version: 173 63724F5E10B957D5 cdk9_human Cyclin-dependent kinase 9 CDK9 CDC2L4 Cell division protein kinase 9 Serine/threonine-protein kinase PITALRE Cell division cycle 2-like protein kinase 4 C-2K TAK Tat-associated kinase complex catalytic subunit protein protein human Homo sapiens Human MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF DIP protein P50750 original sequence version: 100 DIP protein P50750 original sequence version: 115 DIP protein P50750-1 original sequence version: 119 DIP protein P50750 original sequence version: 170 DIP protein P50750 original sequence version: 184 DIP protein P50750-1 original sequence version: 144 DIP protein P50750 original sequence version: 70 DIP protein P50750 original sequence version: 120 69E851CC6F7A0388 kat5-twist1 7 15 enzyme target enzyme target substrate substrate neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 17 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection acetylation acetylation reaction acetylation 2H Q15672 lys-73 N-acetylated L-Lysine Q15672 lys-76 N-acetylated L-Lysine Yes - the MOD CV term is "acetylated" - not "acetyl" as I would have thought... hist1h4a-brd4-2 4 13 unspecified role unspecified role bait bait lys9 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lys6 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 13 competitor competitor competitor prey prey lys6 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain lys9 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 3B-a kat5-twist1-1 6 17 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 15 enzyme target enzyme target substrate substrate neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. acetylation acetylation reaction acetylation 3E Q15672 lys-73 N-acetylated L-Lysine Q15672 lys-76 N-acetylated L-Lysine Yes - the MOD CV term is "acetylated" - not "acetyl" as I would have thought... kat5-twist1-2 6 13 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection acetylation acetylation reaction acetylation 3Ei P62805 lys-6 N-acetylated L-Lysine P62805 lys-9 N-acetylated L-Lysine Yes - the MOD CV term is "acetylated" - not "acetyl" as I would have thought... brd4-wnt5a 11 14 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association Figure 6 B/C brd4-wnt5a-1 11 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait lys6,lys9,lys13,lys17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain association association Figure 6 B/Ci brd4-wnt5a-2 11 18 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association Figure 6 B brd4-wnt5a-3 5 18 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association Figure 6 B/D, Supp 6D JQ1- a competitive inhibitor of BET proteins (including BRD4) TNFalpha or EGF/insulin brd4-wnt5a-3 5 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Figure 6 B/C/D, Supp 6D/E JQ1- a competitive inhibitor of BET proteins (including BRD4) Knockdown of Twist TNFalpha or EGF/insulin brd4-wnt5a-3 5 13 unspecified role unspecified role bait bait lys6,lys9,lys13,lys17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey association association Figure 6 B/Ci, Supp 6D JQ1- a competitive inhibitor of BET proteins (including BRD4) TNFalpha or EGF/insulin brd4-twist1 3 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain diacetylated_lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-1 twist1-brd4 2 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:36:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg,lys76arg' Tue Jun 30 16:23:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys73Arg;Lys76Arg]' Q15672:p.Lys73Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:13:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg' Tue Jun 30 18:22:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys73Arg' Q15672:p.Lys76Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:07:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys76arg' Tue Jun 30 15:43:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys76Arg' 15-30 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey O60885-1:p.Asp144His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain D H Wed May 02 17:49:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp144his' Tue Jun 30 17:02:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp144His' O60885-1:p.His437Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H D Wed May 02 17:11:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his437asp' Tue Jun 30 20:14:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His437Asp' bd2_domain required to bind necessary binding region required to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A/D/E/F, 2A/F/G, 4C Trichostatin (TSA) - a histone deacetylase inhibitor. Mutation of the conserved tyrosine and asparagine residues in the acetyllysine binding pocket of BD2 to alanine (BD2YN) reduced its binding to Twist. JQ1, a BET-specific bromodomain inhibitor brd4-twist1-1 2 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bd2_domain required to bind necessary binding region required to bind range range range range O60885-1:p.Asp144His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain D H Wed May 02 20:21:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp144his' Tue Jun 30 18:13:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp144His' O60885-1:p.His437Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H D Wed May 02 15:25:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his437asp' Tue Jun 30 16:19:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His437Asp' 15 unspecified role unspecified role prey prey Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 20:03:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg,lys76arg' Tue Jun 30 16:35:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys73Arg;Lys76Arg]' Q15672:p.Lys73Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Wed May 02 17:58:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg' Tue Jun 30 19:09:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys73Arg' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q15672:p.Lys76Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Wed May 02 17:00:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys76arg' Tue Jun 30 16:39:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys76Arg' physical association physical association 1A-2/D/E/F, 2A/F/G, 4C Trichostatin (TSA) - a histone deacetylase inhibitor. Mutation of the conserved tyrosine and asparagine residues in the acetyllysine binding pocket of BD2 to alanine (BD2YN) reduced its binding to Twist. JQ1, a BET-specific bromodomain inhibitor twist1-brd4-2 10 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physical association physical association 1B Trichostatin (TSA) - a histone deacetylase inhibitor. brd4-twist1-2 8 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait physical association physical association 1B Trichostatin (TSA) - a histone deacetylase inhibitor. twist1-brd4-4 4 15 competitor competitor competitor prey prey lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 3Bi twist1-brd4-6 2 12 unspecified role unspecified role prey prey bd1+2_domain required to bind necessary binding region required to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:20:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg,lys76arg' Tue Jun 30 19:01:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys73Arg;Lys76Arg]' association association 4D Trichostatin (TSA) - a histone deacetylase inhibitor. brd4-hist1h4a 2 12 unspecified role unspecified role bait bait bd2_domain required to bind necessary binding region required to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:07:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg,lys76arg' Tue Jun 30 18:06:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys73Arg;Lys76Arg]' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4Di Trichostatin (TSA) - a histone deacetylase inhibitor. brd4-hist1h4a-1 2 13 unspecified role unspecified role prey prey possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait bd1_domain required to bind necessary binding region required to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4Dii Trichostatin (TSA) - a histone deacetylase inhibitor. hist1h4a-brd4-3 1 12 unspecified role unspecified role prey prey bd1+bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Fri Jul 22 11:07:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys76arg,lys73arg' Wed May 02 17:04:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg,lys76arg' Tue Jun 30 18:18:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys73Arg;Lys76Arg]' possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4Diii Trichostatin (TSA) - a histone deacetylase inhibitor. hist1h4a-brd4-4 1 12 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range bd1_domain sufficient to bind sufficient binding region sufficient to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4Div Trichostatin (TSA) - a histone deacetylase inhibitor. twist1-brd4-7 2 15 unspecified role unspecified role bait bait possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:46:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys73arg,lys76arg' Tue Jun 30 19:17:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys73Arg;Lys76Arg]' 12 unspecified role unspecified role prey prey bd2_domain required to bind necessary binding region required to bind range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4D-2 Trichostatin (TSA) - a histone deacetylase inhibitor. twist1-brd4-9 2 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6E RNA polymerase 2 was also detected in this complex, but the interacting subunit has not been identified. twist1-brd4-10 9 14 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6Ei RNA polymerase 2 was also detected in this complex, but the interacting subunit has not been identified. hist1h4a-brd4-5 4 13 unspecified role unspecified role bait bait lys9 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true lys6 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range true human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 3B-A twist1-brd4-11 4 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true certain certain sequence position certain certain certain sequence position certain true n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range true human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 3Bi-A brd4-twist1-3 3 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range true region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 15 unspecified role unspecified role neutral component neutral component lys73 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-2 brd4-twist1-4 3 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range true region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true physical association physical association BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-3 brd4-twist1-5 3 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range true 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-4 twist1-brd4-12 4 13 competitor competitor competitor prey prey lys9 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain true lys6 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain true chemical synthesis Chemical synthesis (Chemical synthesis) 15 unspecified role unspecified role bait bait lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true certain certain sequence position certain certain certain sequence position certain true n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range true human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 3Bi hist1h4a-brd4-6 4 15 competitor competitor competitor prey prey lys6 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain true lys9 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain true chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range true human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait lys9 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true lys6 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain true n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 3B