IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer again, not sure to add stoichiometry hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer Not sure wether to add stoichiometry here; hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mgc-803 Homo sapiens mgc-803 Human-poorly differentiated human gastric adenocarcinoma MGC803 Original paper: - no pmid available. K.H. Wang The establishment and biological characteristics of a poorly differentiated human gastric adenocarcinoma MGC803 cell line. Acta Biol. Exp. Sin., 16 (1983), pp. 257–267 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer Entered as a 'Physical assoc' as expression system/purification/tags unknown. Cannot see if Tags have been removed or not...? For VGLL4 mutants, values obtained of less than 50% of WT maximal response, have been entered as a "decreasing or disrupting mutation". TEAD4 is stated to be of Human origin-quote:-"According to the structural analysis, we designed a series of mutations based on human VGLL4 and TEAD4 to probe and disturb the complex interface (Figure S3F). In vitro biolayer interferometry (BLI) and pull-down assays were subsequently performed to assess the importance of individual amino acids on the interface (Figures 3D and 3E). It has been assumed that for constructs used in Figure 4 BLI assay the same species of origin were used. hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer No Species of "recombinant proteins" are given -- no reply to emails. I have entered the "tandem-tdu" of VGLL4 as Murine, as this is mentioned in Supplement - though if it is used here??? References for YAP are ambiguous - both murine + human constructs mentioned. Participant detection is stated to be by "Coomassie blue staining OR western blot." TEAD4 is stated to be of Human origin-quote:-"According to the structural analysis, we designed a series of mutations based on human VGLL4 and TEAD4 to probe and disturb the complex interface (Figure S3F). In vitro biolayer interferometry (BLI) and pull-down assays were subsequently performed to assess the importance of individual amino acids on the interface (Figures 3D and 3E). VGLL4 has been entered as Human, as used in figure 4F, due to mutation mapping. MBP-YAP has also been entered as Human, as (Figure 2I) this is the only species mentioned for this protein throughout this publication. GST-TEAD has also been entered as being of Human origin, as this is stated in Figure 2I, although murine proteins are used elsewhere in this publication hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mgc-803 Homo sapiens mgc-803 Human-poorly differentiated human gastric adenocarcinoma MGC803 Original paper: - no pmid available. K.H. Wang The establishment and biological characteristics of a poorly differentiated human gastric adenocarcinoma MGC803 cell line. Acta Biol. Exp. Sin., 16 (1983), pp. 257–267 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer NO cell line given is given figure Figure 3G in this publication. The Supplement Methods section states:- "Immunoblotting and immunoprecipitation were performed as described previously (Shi et al., 2013)." The only cell line mentioned for IP in Shi et al., is HEK293T, so this has been entered here. ?delete this expt - the cell line assignment is dubious to put it mildly.. hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. Cancer Cell (1535-6108) 2014 imex curation Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Accepted 2015-JAN-12 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL DIP protein P46937 original sequence version: 143 DIP protein P46937 original sequence version: 98 DIP protein P46937-1 original sequence version: 110 DIP protein P46937 original sequence version: 149 DIP protein P46937 original sequence version: 153 DIP protein P46937 original sequence version: 157 DIP protein P46937 original sequence version: 160 DIP protein P46937 original sequence version: 122 DIP protein P46937 original sequence version: 124 6145F7049ED338AE cdx2_human_gene CDX2_HUMAN_GENE gene gene human Homo sapiens Human ctgf_human_gene CTGF_HUMAN_GENE gene gene human Homo sapiens Human tead4_mouse Transcriptional enhancer factor TEF-3 Tead4 Tcf13r1 Tef3 Tefr1 ETF-related factor 2 TEA domain family member 4 TEF-1-related factor 1 TEF-1-related factor FR-19 protein protein mouse Mus musculus Mouse MTSNEWSSPDSPEGSSISGGSQALDKPIDNDAEGVWSPEIERSFQEALAIYPPCGRRKIILTEEGKMYGRNELIARHIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGYPAISGFWQGALPGQPGTSHDVKPFSQNTYPVQPPLPLPGFESPAGPTPSPSAPLAPPWQGRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE 8A0E9749840D88EC tead4_human Transcriptional enhancer factor TEF-3 TEAD4 RTEF1 TCF13L1 TEF3 TEA domain family member 4 Transcription factor RTEF-1 Transcription factor 13-like 1 protein protein human Homo sapiens Human MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE DIP protein Q15561 original sequence version: 131 DIP protein Q15561-1 original sequence version: 138 544DDFD86E88D9A8 super_tdu Super_tdu-YAP1-VGLL4 fusion protein peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE alanine (Lys-Ala-Leu-Gly) was mutated to serine (Lys-Ser-Leu-Gly) for better solubility vgll4_human Transcription cofactor vestigial-like protein 4 VGLL4 KIAA0121 protein protein human Homo sapiens Human METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS A5EA4C167CC8F0B4 vgll4_mouse Transcription cofactor vestigial-like protein 4 Vgll4 protein protein mouse Mus musculus Mouse MLFMKMDLLNYQYLDKMNNNIGVLCYEGEASLRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDKDLDCENDHVSKMSRIFSPHLNKTVNGDCRRDPRERSRSPIERAAAPAVSLHGGHLYASLPSLMEQPLALTKNSSDTGRSAVERQQNRPSVITCASAGARNCNLSHCPIAHSGCSAPGSASYRRPPSATATCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDSASSSPESASRRGQPASPTAHMVSHSHSPSVVS D146298040801D8F tead4-vgll4-1 4 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey Q14135:p.His240Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain H A Wed May 02 15:44:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his240ala' Tue Jun 30 16:16:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His240Ala' Q14135:p.Leu245Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:12:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu245ala' Tue Jun 30 16:15:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu245Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:18:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his240ala,phe241ala Fri Jul 22 11:11:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his240ala,phe241ala' Wed May 02 15:49:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe240-241ala_ala' Tue Jun 30 18:51:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His240_Phe241delinsAlaAla' Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain HF AA certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:18:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his212ala,phe213ala,his240ala,phe241ala Fri Jul 22 11:11:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his212ala,phe213ala,his240ala,phe241ala' Wed May 02 15:37:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe212-213ala_ala,his_phe240-241ala_ala' Tue Jun 30 19:17:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla]' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3D, 4G I have added ONE extra mutation -L245A which is not mentioned in the text.... tead4-vgll4-2 5 15 unspecified role unspecified role prey prey Q14135:p.Trp249Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:26:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp249ala' Tue Jun 30 18:13:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp249Ala' Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain HF AA certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:18:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his212ala,phe213ala,his240ala,phe241ala Fri Jul 22 11:00:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his212ala,phe213ala,his240ala,phe241ala' Wed May 02 19:24:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe212-213ala_ala,his_phe240-241ala_ala' Tue Jun 30 19:24:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla]' Q14135:p.Leu245Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:23:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu245ala' Tue Jun 30 17:36:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu245Ala' Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:18:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his240ala,phe241ala Fri Jul 22 10:56:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his240ala,phe241ala' Wed May 02 17:56:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe240-241ala_ala' Tue Jun 30 16:20:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His240_Phe241delinsAlaAla' Q14135:p.His240Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain H A Wed May 02 15:03:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his240ala' Tue Jun 30 16:04:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His240Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3E I have added TWO extra mutations -L245A and W249A- not mentioned in the text.... tead4-vgll4-3 7 15 unspecified role unspecified role prey prey Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:07:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his240ala,phe241ala Fri Jul 22 11:05:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his240ala,phe241ala' Wed May 02 14:48:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe240-241ala_ala' Tue Jun 30 16:50:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His240_Phe241delinsAlaAla' Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain HF AA certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:07:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his212ala,phe213ala,his240ala,phe241ala Fri Jul 22 11:04:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his212ala,phe213ala,his240ala,phe241ala' Wed May 02 18:32:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe212-213ala_ala,his_phe240-241ala_ala' Tue Jun 30 17:33:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla]' undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:59 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'his212ala,213ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3G I have added TWO extra mutations -L245A and W249A- not mentioned in the text.... tead4-vgll4-4 5 16 unspecified role unspecified role prey prey purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4E tead4-vgll4-7 5 9 competitor competitor competitor prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association 4Ei tead4-vgll4-8 5 13 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 16 competitor competitor competitor prey prey purified purified tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 4Eii (RHS) tead4-vgll4-9 5 13 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4Eiii (RHS) yap1-tead4 5 9 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 competitor competitor competitor prey prey purified purified Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain HF AA certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:17:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his212ala,phe213ala,his240ala,phe241ala Fri Jul 22 11:01:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his212ala,phe213ala,his240ala,phe241ala' Wed May 02 17:17:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe212-213ala_ala,his_phe240-241ala_ala' Tue Jun 30 19:19:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla]' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain HF AA Thu Jul 07 12:17:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his240ala,phe241ala Fri Jul 22 11:11:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his240ala,phe241ala' Wed May 02 14:56:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe240-241ala_ala' Tue Jun 30 16:26:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His240_Phe241delinsAlaAla' ecoli Escherichia coli (strain K12) association association 4F tead4-vgll4-10 4 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 4G yap1-tead4-1 3 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5B yap1-super 3 14 competitor competitor competitor prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 5Bi yap1-tead4-2 6 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 5F yap1-super-1 6 9 unspecified role unspecified role bait bait 14 competitor competitor competitor prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey association association 5Fi Super_tdu decreases expression at RNA level of ENSG00000118523 yap1-ctgf 6 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 5Fii yap1-ctgf-1 6 10 unspecified role unspecified role prey prey 14 competitor competitor competitor prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait association association 5Fiv Super_tdu decreases expression at RNA level of ENSG00000165556 super-tead4 5 13 unspecified role unspecified role prey prey human-mgc-803 Homo sapiens mgc-803 Human-poorly differentiated human gastric adenocarcinoma MGC803 Original paper: - no pmid available. K.H. Wang The establishment and biological characteristics of a poorly differentiated human gastric adenocarcinoma MGC803 cell line. Acta Biol. Exp. Sin., 16 (1983), pp. 257–267 14 unspecified role unspecified role bait bait n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5K tead4-vgll4-12 2 12 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yap_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 127 130 direct interaction direct interaction Supp 3A tead4-vgll4-13 1 12 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yap_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 134 137 direct interaction direct interaction Supp 3B tead4-vgll4-14 8 12 unspecified role unspecified role neutral component neutral component yap_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 143 140 direct interaction direct interaction Supp 3C-E, Supp table 6. 2.9A Rwork = 0.19 Rfree = 0.25 The Tandem TDU region of VGLL4 forms an intermolecular beta-sheet with two TEAD4 molecules; VGLL4 -TDU1 and TDU2 appear to function as individual binding units for separate TEADs molecules. tead4-super 5 14 unspecified role unspecified role prey prey super_tdu:p.[His5_Phe6delinsAlaAla;Met34Ala;Phe43Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain HF AA certain certain sequence position certain certain certain sequence position certain M A Thu Jul 07 12:18:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was his5ala,phe6ala,met34ala,phe43ala Fri Jul 22 11:00:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his5ala,phe6ala,met34ala,phe43ala' Wed May 02 18:41:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_phe5-6ala_ala,met34ala,phe43ala' Tue Jun 30 19:26:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His5_Phe6delinsAlaAla;Met34Ala;Phe43Ala]' n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range super_tdu:p.[Met34Ala;Phe43Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:54:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met34ala,phe43ala' Tue Jun 30 16:21:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met34Ala;Phe43Ala]' ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp 4C The Experimental Proceedures section does not specify which of the two phenlyalanines is mutated in the MF2A mutant.