IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-smmc7721 Human SMMC7721 Hepatoma cell line smmc7721 SMMC7721 Hepatoma cell line This cell line originated in China prior to 1980. No PMID reference findable but:- Tong R et al., The establishment and primary biological characteristics of human hepatoma SMMC-7721 cell line.J 2nd Milit Med Univ, 1980;1(1):5-9. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer Re-ChIp assay The "VEGF" gene was identified as VEGFA from primer sequences supplied. chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-smmc7721 Human SMMC7721 Hepatoma cell line smmc7721 SMMC7721 Hepatoma cell line This cell line originated in China prior to 1980. No PMID reference findable but:- Tong R et al., The establishment and primary biological characteristics of human hepatoma SMMC-7721 cell line.J 2nd Milit Med Univ, 1980;1(1):5-9. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer The "VEGF" gene was identified as VEGFA from primer sequences supplied. chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-smmc7721 Human SMMC7721 Hepatoma cell line smmc7721 SMMC7721 Hepatoma cell line This cell line originated in China prior to 1980. No PMID reference findable but:- Tong R et al., The establishment and primary biological characteristics of human hepatoma SMMC-7721 cell line.J 2nd Milit Med Univ, 1980;1(1):5-9. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer Interactions involving SUMO2/3 have not been entered as it is not known if one or both proteins were detected. chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cbx4 Governs HIF-1α to Potentiate Angiogenesis of Hepatocellular Carcinoma by Its SUMO E3 Ligase Activity. Cancer Cell (1535-6108) 2014 imex curation Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer chengq@shsmu.edu.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep2 Homo sapiens hep2 hep2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Li J., Xu Y., Long X.D., Wang W., Jiao H.K., Mei Z., Yin Q.Q., Ma L.N., Zhou A.W., Wang L.S., Yao M., Xia Q., Chen G.Q. Cancer - Interactions investigated in the context of cancer Re-ChIp assay The "VEGF" gene was identified as VEGFA from primer sequences supplied. chengq@shsmu.edu.cn Accepted 2014-FEB-20 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D cbx4_human E3 SUMO-protein ligase CBX4 Chromobox protein homolog 4 Polycomb 2 homolog CBX4 protein protein human Homo sapiens Human MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHQYQPHSKERAGKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGAKSHPPDKWAQGAGAKGYLGAVKPLAGAAGAPGKGSEKGPPNGMMPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIKSGEVAEGEARSPSHKKRAADERHPPADRTFKKAAGAEEKKVEAPPKRREEEVSGVSDPQPQDAGSRKLSPTKEAFGEQPLQLTTKPDLLAWDPARNTHPPSHHPHPHPHHHHHHHHHHHHAVGLNLSHVRKRCLSETHGEREPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV DF5C8C4C0CCB1F31 arnt_human Aryl hydrocarbon receptor nuclear translocator ARNT Dioxin receptor, nuclear translocator Hypoxia-inducible factor 1-beta BHLHE2 Class E basic helix-loop-helix protein 2 protein protein human Homo sapiens Human MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE DIP protein P27540 original sequence version: 118 DIP protein P27540 original sequence version: 160 DIP protein P27540-1 original sequence version: 160 2E278F8E62BFBF6D sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 vegfa_human_gene Human VEGFA gene gene gene human Homo sapiens Human hif1a-arnt-4 4 10 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 5A I have NOT made a separate Expt for the anti-tag WB - as all proteins are detected in the same IP - added as "identification method" to the Cbx4 molecule instead. hypoxia hif1a-arnt-5 5 10 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sim1_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain O00257:p.Phe11Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:59:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe11ala' Tue Jun 30 17:19:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe11Ala' O00257:p.Trp35Leu mutation mutation certain certain sequence position certain certain certain sequence position certain W L Wed May 02 17:11:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp35leu' Tue Jun 30 18:19:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp35Leu' chromo_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B/H Not sure I have got this right - seems odd to me that aas 1-60 (CDM) WILL bind in the absence of aas 262-5 (SIM1) yet if you delete aas 262-5 (delta SIM1) there is no binding (yet CDM is still present according to Fig 3A..) cbx4-hif1a 5 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C cbx4-hif1a-1 7 9 unspecified role unspecified role prey prey in vitro In vitro 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5D hif1a-arnt-6 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5E hypoxia hif1a-cbx4 6 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5E hypoxia hif1a-cbx4-1 2 9 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 5F cbx4-hif1a-2 2 10 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 5G hif1a-cbx4-2 5 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5I HIF-1a sumoylation was stimulated by PIASy and also by cbx4 in a dose dependent manner; sumoylation was decreased by SenP1. hif1a-arnt-7 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association 5J/K HIF-1a protein could be sumoylated, which was significantly blocked by Cbx4 silencing. All three CBX4 SIMs-deleted mutants could not stimulate hypoxia-stabilized HIF-1a protein modification with SUMO-1 and SUMO-2/3. hif1a-vegfa-3 3 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait association association 4C Cbx4 - WT and CDM only. Hypoxia. hif1a-vegfa-4 3 9 unspecified role unspecified role bait bait Q16665:p.[Lys391Arg;Lys477Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:59:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys391arg,lys477arg' Tue Jun 30 15:35:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys391Arg;Lys477Arg]' Q16665:p.[Pro402Ala;Pro564Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:42:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564ala' Tue Jun 30 20:18:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Ala]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6B HIF-1a has mutations of prolines 402 and 564 into alanines to prevent its hydroxylation and thus degradation under normoxia. Cbx4 - WT and CDM only. PIASy - effect reversed by SENP1. cbx4-hif1a-6 1 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey Q16665:p.[Pro402Ala;Pro564Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 19:54:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564ala' Tue Jun 30 15:38:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Ala]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16665:p.[Lys391Arg;Lys477Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 20:06:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys391arg,lys477arg' Tue Jun 30 18:07:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys391Arg;Lys477Arg]' 10 unspecified role unspecified role bait bait association association 6F HIF-1a has mutations of prolines 402 and 564 into alanines to prevent its hydroxylation and thus degradation under normoxia. cbx4-hif1a-4 1 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey association association 6D Hypoxia. Q16665 increases expression at RNA level of ENSG00000112715 Q16665 increases expression at protein level of ENSG00000112715 cbx4-hif1a-7 8 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16665:p.[Lys391Arg;Lys477Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:44:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys391arg,lys477arg' Tue Jun 30 18:15:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys391Arg;Lys477Arg]' Q16665:p.[Pro402Ala;Pro564Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:12:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564ala' Tue Jun 30 17:36:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Ala]' 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6G HIF-1a has mutations of prolines 402 and 564 into alanines to prevent its hydroxylation and thus degradation under normoxia. cbx4-hif1a-7 8 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey association association 6E Hypoxia. cbx4-hif1a-8 1 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5C Hypoxia. hif1a-cbx4-3 5 10 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait Q16665:p.[Pro402Ala;Pro564Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:43:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564ala' Tue Jun 30 20:13:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Ala]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 5D cbx4-hif1a-9 1 13 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey Q16665:p.[Pro402Ala;Pro564Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 20:19:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564ala' Tue Jun 30 19:35:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Ala]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16665:p.[Lys391Arg;Lys477Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:44:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys391arg,lys477arg' Tue Jun 30 16:55:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys391Arg;Lys477Arg]' 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5E HIF-1a has mutations of prolines 402 and 564 into alanines to prevent its hydroxylation and thus degradation under normoxia.