IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell (1535-6108) 2013 imex curation Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Accepted 2013-DEC-16 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell (1535-6108) 2013 imex curation Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Accepted 2013-DEC-16 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell (1535-6108) 2013 imex curation Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Cyclin D and p300 both have an HA tag; when both are present it has been assumed their presence/absence after an IP has been demonstrated by the molecular weight of the respective bands. Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Accepted 2013-DEC-16 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell (1535-6108) 2013 imex curation Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Accepted 2013-DEC-16 by PPORRAS Time after addition of 10% serum. (origin of serum is undisclosed) Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell (1535-6108) 2013 imex curation Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Cyclin D and p300 both have an HA tag; when both are present it has been assumed their presence/absence after an IP has been demonstrated by the molecular weight of the respective bands. Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Accepted 2013-DEC-16 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell (1535-6108) 2013 imex curation Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Accepted 2013-DEC-16 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell (1535-6108) 2013 imex curation Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer I cannot fine any info about pCS4 vector (for N/C terminal location of tags) Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Accepted 2013-DEC-16 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation hdac5_human Histone deacetylase 5 Antigen NY-CO-9 HDAC5 KIAA0600 protein protein human Homo sapiens Human MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEITGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL DIP protein Q9UQL6 original sequence version: 158 DIP protein Q9UQL6 original sequence version: 92 CF4BE774E3588FEC brd2_human Bromodomain-containing protein 2 BRD2 KIAA9001 RING3 O27.1.1 Really interesting new gene 3 protein protein protein human Homo sapiens Human MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSESSSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKPVGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSSSDSSSSSSSSSSSDTSDSDSG DIP protein P25440 original sequence version: 142 9A075EEB13507D8E ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB runx3_human Runt-related transcription factor 3 RUNX3 AML2 CBFA3 PEBP2A3 Core-binding factor subunit alpha-3 Acute myeloid leukemia 2 protein Oncogene AML-2 Polyomavirus enhancer-binding protein 2 alpha C subunit SL3-3 enhancer factor 1 alpha C subunit SL3/AKV core-binding factor alpha C subunit protein protein human Homo sapiens Human MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY 593FBFB3C4639BBD hdac4_human Histone deacetylase 4 HDAC4 KIAA0288 protein protein human Homo sapiens Human MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL DIP protein P56524 original sequence version: 158 DIP protein P56524 original sequence version: 149 DIP protein P56524 original sequence version: 151 BB7FD37652D12398 ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI DIP protein P24385 original sequence version: 163 DIP protein P24385 original sequence version: 165 DIP protein P24385 original sequence version: 160 DIP protein P24385 original sequence version: 121 DIP protein P24385 original sequence version: 122 DIP protein P24385 original sequence version: 143 DIP protein P24385 original sequence version: 127 3CC00C9905F58D3A brd2-runx3 3 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13761:p.[Lys94Arg;Lys171Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:25:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94arg,lys171arg' Tue Jun 30 16:35:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Arg;Lys171Arg]' Q13761:p.Lys171Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:54:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys171arg' Tue Jun 30 19:44:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys171Arg' Q13761:p.Lys94Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:01:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94arg' Tue Jun 30 19:00:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys94Arg' Q13761:p.[Lys87Arg;Lys94Arg;Lys129Arg;Lys148Arg;Lys171Arg;Lys186Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Fri Jul 22 11:11:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys186arg,lys87arg,lys129arg,lys148arg,lys171arg,lys94arg' Wed May 02 18:02:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys87arg,lys94arg,lys129arg,lys148arg,lys171arg,lys186arg' Tue Jun 30 17:31:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys87Arg;Lys94Arg;Lys129Arg;Lys148Arg;Lys171Arg;Lys186Arg]' 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bromo1_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4F/G, 5B/C, 6E, Supp. 4 H and G. HA-p300 Supplementary Figure 4H gives details for deletion constructs of (human) BRD2; however the sequences are given in relation to a 802 amino acid protein which cannot be traced. (this protein has been asssumed to be human as no other species appears to have an 802 amino acid BRD2 protein- the human protein has 801 amino acids.). In cells expressing K-RasG12V and MEK1-CA the BRD2-RUNX3 interaction and expression of p21 and ARF was maintained. In cells expressing Myc-RUNX3-KR-94-171, (which cannot form the RUNX3-BRD2 complex), K-RasG12V and MEK1-CA failed to induce ARF and p21. brd2-runx3-1 4 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 5A/D, 6A Acetylation of RUNX3 and formation of the RUNX3-BRD2 complex peaked after 2 hr of stimulation and declined after 4 hr 1-4 hours Expression of K-RasG12V triggered the formation of the BRD2/RUNX3 complex and prolonged the duration of this interaction. brd2-ep300-1 4 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 5A 0 time runx3-ccnd1 4 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association 5A/D 1-4 hours Knockdown of Cyclin D1 inhibited deacetylation of RUNX3 and dissociation of the RUNX3-BRD2 complex and prolonged the expression of ARF and p21. runx3-ccnd1-1 4 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association 5A 8 hours runx3-ccnd1-7 3 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5E HA-p300 runx3-ccnd1-2 5 13 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 10 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5E lanes 6,7,8. Cyclin D1 facilitated the release of p300 from RUNX3 and promoted the RUNX3-HDAC4 interaction but not the RUNX3-HDAC5 interaction. runx3-ep300 5 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5Ei lane 3 runx3-ep300-2 5 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5E lane 4 Cyclin D1 facilitated the release of p300 from RUNX3 and promoted the RUNX3-HDAC4 interaction but not the RUNX3-HDAC5 interaction. runx3-ep300-4 5 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5E lane 5 Cyclin D1 facilitated the release of p300 from RUNX3 and promoted the RUNX3-HDAC4 interaction but not the RUNX3-HDAC5 interaction. runx3-brd2-5 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 6Ai lanes 2+3 1-2 hours Expression of K-RasG12V triggered the formation of the BRD2/RUNX3 complex and prolonged the duration of this interaction. runx3-ccnd1-3 4 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 6A lanes 4+5 4-8 hours RUNX3-Cyclin D1 and RUNX3-HDAC4 interactions were markedly reduced in cells expressing K-RasG12V. brd2-runx3-2 7 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 7A The RUNX3-BRD2 complex was formed and stably maintained due to the endogenous oncogenic K-Ras. brd2-runx3-3 1 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13761:p.[Lys94Arg;Lys171Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:26:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94arg,lys171arg' Tue Jun 30 18:53:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Arg;Lys171Arg]' physical association physical association 7B brd2-runx3-4 6 11 unspecified role unspecified role prey prey Q13761:p.[Lys94Arg;Lys171Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:48:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94arg,lys171arg' Tue Jun 30 19:51:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Arg;Lys171Arg]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait physical association physical association 7C In a cell line that expresses little or no RUNX3 (or ARF,p21 or p53) (over) expression of RUNX3 resulted in formation of a stable RUNX3-BRD2 complex and expression of ARF, p21, and p53, -whereas the (over) expression of RUNX3-KR-94-171 did not. brd2-runx3-5 2 11 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Supp 5A brd2-runx3-6 3 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 6 Lane 1i and lanes 3-6 The additional presence of HA-Cyclin D1 (lane 2) disrupted this interaction. The presence of MEK1-CA did not disrupt this interaction. runx3-ccnd1-4 3 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 6 Lane 1ii, lanes 3 and 6. The presence of MEK1-CA blocked the interaction with Cyclin D1 and HDAC4. runx3-ccnd1-5 5 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 6 Lane 2ii HA-p300 was not detected. runx3-ccnd1-6 5 10 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey 13 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 6 lanes 4 and 5 The presence of MEK1-CA reduced this interaction and disrupted it completely at the highest concentration of MEK1-CA. This interaction did not occur in the absence of CyclinD1.