IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. Cancer Cell (1535-6108) 2013 imex curation Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer weinberg@wi.mit.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hmle_namec Homo sapiens_Hmle_namec:Human mammary epithelial cell line (immortalized)- stable post EMT cells. hmle_namec Human mammary epithelial cell line (immortalized)- stable post EMT cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer Not sure if I should have added a new cell line for Namecs - but did so as they are significantly different from Hmles. NAMECS:-Naturally Arising MEsenchymal Cells (NAMECs), isolated from bulk cultures of HMLE cells:these cells thave spontaneously undergone an EMT and are in a stable mesenchymal state. weinberg@wi.mit.edu Accepted 2013-NOV-21 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. Cancer Cell (1535-6108) 2013 imex curation Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer weinberg@wi.mit.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hmle Homo sapiens hmle Human immortalized mammary epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer weinberg@wi.mit.edu Accepted 2013-NOV-21 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. Cancer Cell (1535-6108) 2013 imex curation Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer weinberg@wi.mit.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hmle Homo sapiens hmle Human immortalized mammary epithelial cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer Figure 6: EMT was induced in HMLEs by ectopic expression of either the Twist or Snail transcription factors, (The authors have confirmed that the cells used in the assay were HMLE-Twist and HMLE-Snail cells.) weinberg@wi.mit.edu Accepted 2013-NOV-21 by PPORRAS Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation fos_human_gene Human FOS gene gene gene human Homo sapiens Human twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH DIP protein Q15672 original sequence version: 156 DIP protein Q15672 original sequence version: 159 9394E4351BA1D081 fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 jund_human Transcription factor jun-D JUND protein protein human Homo sapiens Human METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY DIP protein P17535 original sequence version: 147 DIP protein P17535 original sequence version: 119 FE85A1AA2B5B9597 junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF DIP protein P17275 original sequence version: 151 DIP protein P17275 original sequence version: 118 DIP protein P17275 original sequence version: 143 DF8CD1CD4409C6BE snai1_human Zinc finger protein SNAI1 Protein snail homolog 1 SNAI1 SNAH protein protein human Homo sapiens Human MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR DIP protein O95863 original sequence version: 109 DIP protein O95863 original sequence version: 141 70E298C9BB154115 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 cadh1_human_gene Human CDH1gene:Epithelial cadherin gene gene human Homo sapiens Human fosl1_human Fos-related antigen 1 FOSL1 FRA1 protein protein human Homo sapiens Human MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL DIP protein P15407 original sequence version: 146 1B6492D709E66570 crum3_human_gene CRUM3_HUMAN_GENE gene gene human Homo sapiens Human fosl1_human_gene FOSL1_HUMAN_GENE gene gene human Homo sapiens Human fosl1-jun-1 1 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 5Di jun-fos-1 1 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association 5Dii fos-fosl1 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association 5Diii fos-fzr1 3 11 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait association association 5E fos-fzr1-1 3 6 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5E twist1-fosl1 3 14 unspecified role unspecified role prey prey tss_and_first _intron binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association 6F Q15672 increases expression of ENSG00000175592 twist1-fosl1-1 3 9 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey tss_and_first _intron binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6F the promoter of FOS was only weakly enriched for Twist and Snail binding O95863 increases expression of ENSG00000175592 twist1-fosl1-2 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6F snai1-fosl1 3 4 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait association association 6F the promoter of FOS was only weakly enriched for Twist and Snail binding