IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell (0092-8674) 2013 imex curation Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell (0092-8674) 2013 imex curation Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell (0092-8674) 2013 imex curation Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell (0092-8674) 2013 imex curation Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer Supp Fig. 3C mutants only added as comment as there is no wild type on the gel for comparison. S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). Origin of NF2 and Lats1 inferred from sequence length and mutant mapping. Source of Lats2 could not be traced. djpan@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell (0092-8674) 2013 imex curation Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell (0092-8674) 2013 imex curation Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell (0092-8674) 2013 imex curation Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin F., Yu J., Zheng Y., Chen Q., Zhang N., Pan D. Cancer - Interactions investigated in the context of cancer S2R+ cell line, S2 cells with Wg receptors (expresses Dfz2 and Dfz1 proteins, which function as Wg receptors.). djpan@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation merh_drome Moesin/ezrin/radixin homolog 2 Mer EMR2 CG14228 Ezrin-moesin-radixin 2 Merlin protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSPFGSKKNRSLSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQYVDTRSNVSWLKMEKRVRDQRVELHASNNVYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQSILSMDIYCRPEASVLLASYAVHVQYGPYDYETYKDGMLAGGELLPKGVTDQYQMTPEMWEERIKTWYMDHEPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTSVGLNIYDERDKLTPKTTFQWNEIRHVSFDDKKFTIRLVDAKVSNFIFYSQDLHINKMILDLCKGNHDLYMRRRKPDTMEIQQMKAQAKEEKQRRQIERKKFIREKKLREKAEHERYELEKSMEHLQNEMRMANDALRRSEETKELYFEKSRVNEEQMQLTECKANHFKTEMDRLRERQMKIEREKHDLEKKIRDADFYVHQLTVENDKREAETEKLRKELICAKMAEREATARLLEFLNSGRKSSTDSLLTASSVSHAANTASSMAAISTPSLITSSSTNDLETAGGAELTTHSSHYLVQGDNSSGISDDFEPKEFILTDNEMEQITNEMERNHLDYLRNSKQVQSQLQTLRSEIAPHKIEENQSNLDILSEAQIKAGENKYSTLKKLKSGSTKARVAFFEEL DIP protein Q24564 original sequence version: 91 940D6B8A0D160A3F warts_drome Serine/threonine-protein kinase Warts wts CG12072 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHPAGEKRGGRPNDKYTAEALESIKQDLTRFEVQNNHRNNQNYTPLRYTATNGRNDALTPDYHHAKQPMEPPPSASPAPDVVIPPPPAIVGQPGAGSISVSGVGVGVVGVANGRVPKMMTALMPNKLIRKPSIERDTASSHYLRCSPALDSGAGSSRSDSPHSHHTHQPSSRTVGNPGGNGGFSPSPSGFSEVAPPAPPPRNPTACSAATPPPPVPPTSQAYVKRRSPALNNRPPAIAPPTQRGNSPVITQNGLKNPQQQLTQQLKSLNLYPGGGSGAVVEPPPPYLIQGGAGGAAPPPPPPSYTASMQSRQSPTQSQQSDYRKSPSSGIYSATSAGSPSPITVSLPPAPLAKPQPRVYQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASNSPVHVLAAPPSYPQKSAAVVQQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVVQQQQQQQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGNPGRQMLPPPPYQSNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSNTGANSSGGSNGSTGTTASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTFHGFFEFTFRRFFDDKQPPDMTDDQAPVYV DIP protein Q9VA38 original sequence version: 115 DIP protein Q9VA38 original sequence version: 122 DIP protein Q9VA38 original sequence version: 97 7D09D7AA9BA1A856 mob1_drome MOB kinase activator-like 1 Mob as tumor suppressor protein 1 mats Mps one binder kinase activator-like 1 CG13852 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDFLFGSRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKDERQI 6B16E04A08B59208 sav_drome Scaffold protein salvador sav SHRP CG33193 Shar-pei protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNYLTILLCNRKPTMLSRRNKEKSQHKEGVVGKYMKKDTPPDISVINVWSDQRAKKKSLQRCASTSPSCEFHPRSSSTSRNTYSCTDSQPDYYHARRAQSQMPLQQHSHSHPHSLPHPSHPHVRSHPPLPPHQFRASSNQLSQNSSNYVNFEQIERMRRQQSSPLLQTTSSPAPGAGGFQRSYSTTQRQHHPHLGGDSYDADQGLLSASYANMLQLPQRPHSPAHYAVPPQQQQHPQIHQQHASTPFGSTLRFDRAAMSIRERQPRYQPTSSPMQQQQQQQQQQQQQLQHTQLAAHLGGSYSSDSYPIYENPSRVISMRATQSQRSESPIYSNTTASSATLAVVPQHHHQGHLAVPSGSGGGSLSGSGRGGSSGSVRGASTSVQSLYVPPRTPPSAVAGAGGSANGSLQKVPSQQSLTEPEELPLPPGWATQYTLHGRKYYIDHNAHTTHWNHPLEREGLPVGWRRVVSKMHGTYYENQYTGQSQRQHPCLTSYYVYTTSAEPPKAIRPEASLYAPPTHTHNALVPANPYLLEEIPKWLAVYSEADSSKDHLLQFNMFSLPELEGFDSMLVRLFKQELGTIVGFYERYRRALILEKNRRAGQNQNQNQ DIP protein Q9VCR6 original sequence version: 95 05DF47686EE3335E stk4_human Serine/threonine-protein kinase 4 STK4 MST1 STE20-like kinase MST1 Mammalian STE20-like protein kinase 1 Serine/threonine-protein kinase Krs-2 KRS2 protein protein human Homo sapiens Human METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF 150758EBC5F77D5C hippo_drome Serine/threonine-protein kinase hippo hpo dMST Drosophila homolog of MST1 and MST2 STE20-like kinase MST CG11228 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSEPEVTSVVDMKSPNISSSCSFFKLKKLSEESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKPMLEETCAIREQQRANRSFGGVLAASQAKSLATQENGMQQHITDNAFMEDPGTLVPEKFGEYQQSSASDATMIAHAEQGVDEGTLGPGGLRNLSKAAAPAAASSAASPLDMPAVDSGTMVELESNLGTMVINSDSDDSTTAKNNDDQKPRNRYRPQFLEHFDRKNAGDGRGDEKPIATEYSPAAAEQQQQQQQQQQQQQQDEQHLASGANDLNNWEHNMEMQFQQISAINQYGLQQHQQQQQVLMAYPLMNEQLIALNNQPNLLLSNAAPMGQQGIPAAAPAQPPPAYQNQHMHTQSHAYVEGEFEFLKFLTFDDLNQRLCNIDHEMELEIEQLNKKYNAKRQPIVDAMNAKRKRQQNINNNLIKI DIP protein Q8T0S6 original sequence version: 100 B3DDDFAF5F4E4EB3 p35240-1 Merlin I NF2 SCH Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomerlin Schwannomin protein protein human Homo sapiens Human MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL DIP protein P35240-1 original sequence version: 177 B1A1BF2BD5DA561C merl_human Merlin Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomin Schwannomerlin NF2 SCH protein protein human Homo sapiens Human MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL B1A1BF2BD5DA561C lats1_human Serine/threonine-protein kinase LATS1 Large tumor suppressor homolog 1 WARTS protein kinase LATS1 WARTS protein protein human Homo sapiens Human MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQNVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNMELYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV DIP protein O95835 original sequence version: 133 DIP protein O95835 original sequence version: 147 DIP protein O95835 original sequence version: 144 DIP protein O95835 original sequence version: 142 DIP protein O95835-1 original sequence version: 142 11CFBCD8FD87DCD8 wts-mats-1 3 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9VA38:p.Arg708Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 19:20:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg708ala' Tue Jun 30 18:04:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg708Ala' physical association physical association Supp. Fig. 2A wts-mer 3 8 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Figs. 2B, 3E/F, 3G mer-wts 3 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6F, 6H CHEBI:49703 Latrunculin B, actin polymerization inhibitor C3 Rho GTPase inhibitor mer-mer-5 3 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 36 38 physical association physical association Fig. 3B nf2-lats1 4 16 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O95835:p.[Ala77Pro;Ile81Thr;Leu85Pro] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:02:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala77pro,ile81thr,leu85pro' Tue Jun 30 19:52:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala77Pro;Ile81Thr;Leu85Pro]' 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35240:p.Leu46Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R Wed May 02 18:41:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu46arg' Tue Jun 30 19:17:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu46Arg' P35240:p.Phe62Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F S Wed May 02 19:24:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe62ser' Tue Jun 30 18:17:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe62Ser' P35240:p.Leu64Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 16:01:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu64pro' Tue Jun 30 17:03:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu64Pro' P35240:p.Leu141Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 16:45:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu141pro' Tue Jun 30 17:28:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu141Pro' physical association physical association Fig. 3C, 3G, 3I, 4C, Supp Fig. 3C The phosphodeficient S518A mutant of NF2 showed greater ability to bind Lats1 compared to the phosphomimetic S518D mutant. nf2-lats1-1 7 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Fig. 3D nf2-lats1-2 2 14 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O95835:p.[Ala77Pro;Ile81Thr;Leu85Pro] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:12:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala77pro,ile81thr,leu85pro' Tue Jun 30 17:08:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala77Pro;Ile81Thr;Leu85Pro]' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 3E nf2-nf2 4 15 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 62 65 physical association physical association Fig. 3F mer-wts-1 3 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 70 73 physical association physical association Supp. Fig. 4C mer-mer-6 3 8 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 4C hpo-wts 1 13 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Interactors translocate from the cytoplasm to the plasma membrane in the presence of both Sav and Mer1–600 Supp Fig. 6G sav-hpo-2 3 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6G mer-wts-2 5 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig. 6I CHEBI:49703 Latrunculin B, actin polymerization inhibitor C3 Rho GTPase inhibitor mer-wts-3 3 9 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A, 6J, Supp. Fig. 3G lats1-nf2 4 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A mer-wts-4 1 9 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9VA38:p.[Ala20Pro;Ile24Thr;Leu28Pro] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:46:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala20pro,ile24thr,leu28pro' Tue Jun 30 20:12:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala20Pro;Ile24Thr;Leu28Pro]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization Supp. Fig. 4B Introduction of the Wts-Ala20Pro-Ile24Thr-Leu28Pro greatly diminished Mer1–600-induced Wts membrane association lats1-nf2-1 6 15 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O95835:p.[Ala77Pro;Ile81Thr;Leu85Pro] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:34:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala77pro,ile81thr,leu85pro' Tue Jun 30 18:42:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala77Pro;Ile81Thr;Leu85Pro]' colocalization colocalization Fig. 4E lats1-stk4 6 16 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Supp Fig. 6H MST/STK41 and LATS1 translocate from the cytoplasm to the plasma membrane in the presence of both SAV1 and NF2. mer-wts-5 1 9 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9VA38:p.[Ala20Pro;Ile24Thr;Leu28Pro] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 16:04:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala20pro,ile24thr,leu28pro' Tue Jun 30 18:59:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala20Pro;Ile24Thr;Leu28Pro]' 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization Fig 4G, Introduction of the Wts-Ala20Pro-Ile24Thr-Leu28Pro greatly diminished Mer1–600-induced Wts membrane association