IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Cell (0092-8674) 2013 imex curation Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org Accepted 2013-NOV-07 by MGT 22-Nov-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Cell (0092-8674) 2013 imex curation Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org Accepted 2013-NOV-07 by MGT 22-Nov-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Cell (0092-8674) 2013 imex curation Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org Accepted 2013-NOV-07 by MGT 22-Nov-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Cell (0092-8674) 2013 imex curation Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma pull down pull down western blot western blot Immuno blot Immuno blot Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org Accepted 2013-NOV-07 by MGT 22-Nov-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Pharmacological inactivation of Skp2 SCF ubiquitin ligase restricts cancer stem cell traits and cancer progression. Cell (0092-8674) 2013 imex curation Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chan C.H., Morrow J.K., Li C.F., Gao Y., Jin G., Moten A., Stagg L.J., Ladbury J.E., Cai Z., Xu D., Logothetis C.J., Hung M.C., Zhang S., Lin H.K. Cancer - Interactions investigated in the context of cancer Origin of SKP1 and 2 obtained from the authors. Interactions involving AKT were not captured as this could not be ascribed to a single gene product. uzhang@mdanderson.org, hklin@mdanderson.org Accepted 2013-NOV-07 by MGT 22-Nov-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation skp2_human S-phase kinase-associated protein 2 F-box protein Skp2 Cyclin-A/CDK2-associated protein p45 p45skp2 F-box/LRR-repeat protein 1 SKP2 FBXL1 protein protein human Homo sapiens Human MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL F29B7C338A7A37E9 szl-p1-41 3-(1,3-benzothiazol-2-yl)-6-ethyl-7-hydroxy-8-(1-piperidinylmethyl)-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK C794D62AFB75528A skp1-skp2-1 2 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1B skp1-skp2-2 2 7 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 1B, 2D, 5A. SZL-P1-41 (5uM) SZL-P1-41 was unable to inhibit the binding of Skp2 Trp97Ala and Asp98Ala mutants to Skp1 skp2-skp1-6 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 1C SZL-P1-41 (5uM) skp2-skp1-3 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait Q13309:p.Phe109Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:13:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe109ala' Tue Jun 30 16:40:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe109Ala' region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13309:p.Pro101Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:31:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro101ala' Tue Jun 30 17:06:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro101Ala' Q13309:p.Leu105Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:01:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu105ala' Tue Jun 30 18:52:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu105Ala' Q13309:p.Ile108Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 14:25:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile108ala' Tue Jun 30 17:23:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile108Ala' Q13309:p.Arg126Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:52:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg126ala' Tue Jun 30 17:04:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg126Ala' physical association physical association Fig. 1C skp2-szl_p1_41 3 7 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role bait bait Q13309:p.Trp97Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:36:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp97ala' Tue Jun 30 15:51:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp97Ala' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13309:p.Asp98Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:24:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp98ala' Tue Jun 30 19:00:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp98Ala' ecoli Escherichia coli (strain K12) physical association physical association Fig. 2E, 3B skp2-skp1-4 5 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 3A