IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Cancer Cell (1535-6108) 2013 imex curation Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-keratinocyte Mouse Keratinocyte keratinocyte Keratinocyte ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Cancer Cell (1535-6108) 2013 imex curation Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-keratinocyte Mouse Keratinocyte keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Cancer Cell (1535-6108) 2013 imex curation Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions drome-salivary_gland Drosophila melanogaster Salivary gland salivary_gland Salivary gland fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) Polytene chromosomes from third instar larvae. The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Cancer Cell (1535-6108) 2013 imex curation Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Cancer Cell (1535-6108) 2013 imex curation Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-keratinocyte Homo sapiens keratinocyte Keratinocyte ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Cancer Cell (1535-6108) 2013 imex curation Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. Cancer Cell (1535-6108) 2013 imex curation Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-keratinocyte Homo sapiens keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation As of 2/9/13 you will have to access this publication via the Cancer Cell archive - pmid does not have a direct link yet.....I spent a lot of time looking for origins of constructs - I may have missed the obvious - but there is a limit to my time...(and patience...) (Refs Aguilera -2004 gives links for HA-IKBA plasmid to other references, none of which contain relevant info. Camacho-Garcia reference is not relevant to any construct used in this paper,) The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation hbx2_mouse_gene HXB2_MOUSE_GENE/HOXB2 gene gene mouse Mus musculus Mouse hxd1_mouse_gene HXD1_MOUSE_MOUSE/HOXD1 gene gene mouse Mus musculus Mouse hxb2_human_gene HXB2_HUMAN_GENE/HOXB2 gene gene human Homo sapiens Human irx3_human_gene IRX3_HUMAN_GENE gene gene human Homo sapiens Human cact_drome NF-kappa-B inhibitor cactus CG5848 cact protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPSPTKAAEAATKATATSDCSCSAASVEQRAPSNAANPSSSLATSGKIGGKTQDQTAAINKQKEFAVPNETSDSGFISGPQSSQIFSEEIVPDSEEQDKDQQESAPQKEQPVVLDSGIIDEEEDQEEQEKEEEHQDTTTATADSMRLKHSADTGIPQWTVESHLVSRGEQLNNLGQSSSTQITGRSKVQSSTASTANANPSGSGATSSAPPSSINIMNAWEQFYQQNDDGDTPLHLACISGSVDVVAALIRMAPHPCLLNIQNDVAQTPLHLAALTAQPNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAIEGCNEDLANFLLDECEKLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAETVTPPDSDYDSSDIEDLDDTKMYDRFGDPRYFVSYNGGNPMTVA 9E9711B97CDB499F pax6_mouse_gene PAX6_MOUSE_GENE gene gene mouse Mus musculus Mouse ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 hxb5_mouse_gene HXB5_MOUSE_GENE gene gene mouse Mus musculus Mouse tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 irx3_mouse_gene IRX3_MOUSE_GENE gene gene mouse Mus musculus Mouse hxa10_human_gene HOXA10 Human Gene gene gene human Homo sapiens Human h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62806 original sequence version: 108 A9E5DFD3F8B97598 suz12_mouse Polycomb protein Suz12 Suz12 D11Ertd530e Kiaa0160 Suppressor of zeste 12 protein homolog protein protein mouse Mus musculus Mouse MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGGCGGGGSYSASSSSAAAAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSQNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSKEKALETDGVSGVPKQSKKQKL DIP protein Q80U70 original sequence version: 62 DIP protein Q80U70 original sequence version: 85 DIP protein Q80U70 original sequence version: 84 4A6B6E52D24FAEF2 hxa10_mouse_gene HXA10_MOUSE_GENE/HOXA10 gene gene mouse Mus musculus Mouse ikba_mouse_gene IKBA_MOUSE_GENE gene gene mouse Mus musculus Mouse hbx5_human_gene HXB5_HUMAN_GENE/HOXB5 gene gene human Homo sapiens Human ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL DIP protein Q9Z1E3 original sequence version: 86 DIP protein Q9Z1E3 original sequence version: 127 DIP protein Q9Z1E3 original sequence version: 91 E1783F8E1BA93813 foxd2_mouse_gene FOXD2_MOUSE_GENE gene gene mouse Mus musculus Mouse tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 hxd3_human_gene HXD3_HUMAN_GENE gene gene human Homo sapiens Human hxb8_mouse_gene HXB8_MOUSE_GENE gene gene mouse Mus musculus Mouse pc_drome Polycomb group protein Pc Pc CG7618 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTGRGKGSKGKLGRDNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSNSSSSEDQPLIGTKRKAEVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVANEEGNQQAPQVPSENNNIPKPCNNLAINQKQPLTPLSPRALPPRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRERDMKGDSSPVA 5DB24AE4B326C3B9 ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP 7442C751E13EA24B kdm5b_mouse_gene KDM5B_MOUSE_GENE gene gene mouse Mus musculus Mouse nfkbia-rela-6 7 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 2C nfkbia-rela-7 5 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey possible_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3D/E Calcium, TNFa the binding site is -ˆ’18,820 to-ˆ’18,800 from TSS. although I cannot see any other genes in the genomic area I am loathe to call this a promoter - however text refers to enhancer regions (as in "data not shown") - so possibly/probably meant this gene... nfkbia-hxa10 5 14 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3D/Ei Calcium, TNFa nfkbia-irx3 5 10 unspecified role unspecified role prey prey possible_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association 3D/E Calcium, TNFa nfkbia-hxb2 5 23 unspecified role unspecified role prey prey downstream_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association 3D this hoxb5 gene is only ~2000 base pairs long - so as +6000 from TSS the region here is not very near the gene - no idea what to call the feature. nfkbia-hbx5 5 14 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey unknown_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3Di image says HOXD3 gene but legend says HOXB3?? nfkbia-suz12 2 20 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait physical association physical association 4A nfkbia-suz12-1 2 26 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait physical association physical association 4Ai suz12-hx10 1 21 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 4C TNFalpha suz12-hxa10 1 20 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey association association 4Ci TNFalpha suz12-hbx2 1 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 4Cii TNFalpha suz12-hbx2-1 1 20 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 4Ciii TNFalpha suz12-foxd2 1 20 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey association association 4Civ TNFalpha suz12-kdm5b 1 31 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 4Cv TNFalpha suz12-hxd1 6 9 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 4Fi TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. suz12-hxb5 6 20 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 4Fii TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxb8 6 28 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 4Fiii TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. ezh2-hxd1-1 6 30 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 4Fiv TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxb5-1 6 15 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait association association 4Fv TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxb8-1 6 30 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 4Fvi TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxd1-1 6 9 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait association association 4Fvii TNFalpha IKBA binding to all loci occurred in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. suz12-hxb5-2 6 24 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 4Fviii TNFalpha IKBA binding to all loci occurred in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. suz12-hxb8-2 6 24 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 4Fix TNFalpha IKBA binding to all loci occurred in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. cact-pc 3 29 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 5B ezh2-hxb8 1 30 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 6Bi Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb8-1 1 30 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 6Bii Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb5 1 30 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 6Biii Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxd1-2 1 9 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 6Biv Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb8-2 1 28 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 6Bv Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb5-1 1 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 6Bvi Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. hist1h4h-nfkbia 4 24 unspecified role unspecified role prey prey possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined possible_sumo_res sumoylated lysine sumoylated lysine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-keratinocyte Mouse Keratinocyte keratinocyte Keratinocyte 19 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supp 2B rela-ikba 1 26 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey association association Supp 3E It is unclear from the figure legend if this Chip was carried out in Human or Mouse keratinocytes - entered as Mouse on the basis of info given in the main text. suz12-hxa10-1 1 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association 4C TNFalpha cact-rela 4 12 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 5A