IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Targeting BCL-2 with the BH3 Mimetic ABT-199 in Estrogen Receptor-Positive Breast Cancer. Targeting BCL-2 with the BH3 Mimetic ABT-199 in Estrogen Receptor-Positive Breast Cancer. Cancer Cell (1535-6108) 2013 imex curation Vaillant F., Merino D., Lee L., Breslin K., Pal B., Ritchie M.E., Smyth G.K., Christie M., Phillipson L.J., Burns C.J., Mann G.B., Visvader J.E., Lindeman G.J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer visvader@wehi.edu.au, lindeman@wehi.edu.au 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vaillant F., Merino D., Lee L., Breslin K., Pal B., Ritchie M.E., Smyth G.K., Christie M., Phillipson L.J., Burns C.J., Mann G.B., Visvader J.E., Lindeman G.J. Apoptosis - Interactions involving proteins with a function related to apoptosis visvader@wehi.edu.au, lindeman@wehi.edu.au Accepted 2013-AUG-15 by PPORRAS 09-Sep-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Targeting BCL-2 with the BH3 Mimetic ABT-199 in Estrogen Receptor-Positive Breast Cancer. Targeting BCL-2 with the BH3 Mimetic ABT-199 in Estrogen Receptor-Positive Breast Cancer. Cancer Cell (1535-6108) 2013 imex curation Vaillant F., Merino D., Lee L., Breslin K., Pal B., Ritchie M.E., Smyth G.K., Christie M., Phillipson L.J., Burns C.J., Mann G.B., Visvader J.E., Lindeman G.J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer visvader@wehi.edu.au, lindeman@wehi.edu.au 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-breast_cancer Homo sapiens breast cancer tissue breast_cancer Breast cancer tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vaillant F., Merino D., Lee L., Breslin K., Pal B., Ritchie M.E., Smyth G.K., Christie M., Phillipson L.J., Burns C.J., Mann G.B., Visvader J.E., Lindeman G.J. Apoptosis - Interactions involving proteins with a function related to apoptosis Human xenografts of early passage ER+ve breast tumour cells inserted into the inguinal mammary fat pads of 3- or 4-week-old NOD-SCID-IL2R/- female mice. Estradiol pellets were also implanted. visvader@wehi.edu.au, lindeman@wehi.edu.au Accepted 2013-AUG-15 by PPORRAS 09-Sep-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB bcl2-bcl2l11-1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 3B, Supp 3A Tamoxifen - an antagonist of the estrogen receptor ABT-737 a BH3 mimetic-a small-molecule inhibitor of antiapoptotic members of the Bcl-2 family. bcl2-bcl2l11-2 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Supp 3B ABT-737 a BH3 mimetic-a small-molecule inhibitor of antiapoptotic members of the Bcl-2 family. I have removed Tamoxifen as an agonist as there appears to be no difference here.