Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com BAK multimerization for apoptosis, but not bid binding, is inhibited by negatively charged residue in the BAK hydrophobic groove. BAK multimerization for apoptosis, but not bid binding, is inhibited by negatively charged residue in the BAK hydrophobic groove. Mol. Cancer 2013 imex curation Azad A., Storey A. Cancer - Interactions investigated in the context of cancer astorey62@gmail.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Azad A., Storey A. Cancer - Interactions investigated in the context of cancer astorey6 2@gmail.com astorey62@gmail.com Accepted 2013-DEC-23 by MGT Cross-linking reactions performed with 6-bismaleimidohexane or Bismaleimidoethane. Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. BAK multimerization for apoptosis, but not bid binding, is inhibited by negatively charged residue in the BAK hydrophobic groove. BAK multimerization for apoptosis, but not bid binding, is inhibited by negatively charged residue in the BAK hydrophobic groove. Mol. Cancer 2013 imex curation Azad A., Storey A. Cancer - Interactions investigated in the context of cancer astorey62@gmail.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Azad A., Storey A. Cancer - Interactions investigated in the context of cancer astorey6 2@gmail.com astorey62@gmail.com Accepted 2013-DEC-23 by MGT Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bid-bak1-4 2 4 unspecified role unspecified role prey prey Q16611:p.Tyr110Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 17:02:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr110glu' Tue Jun 30 15:50:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr110Glu' 3 unspecified role unspecified role bait bait physical association physical association 3b,c bak1-bak1-1 1 4 unspecified role unspecified role neutral component neutral component Q16611:p.Tyr110Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 17:52:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr110glu' Tue Jun 30 16:41:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr110Glu' 4 unspecified role unspecified role neutral component neutral component Q16611:p.Tyr110Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 17:14:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr110glu' Tue Jun 30 17:37:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr110Glu' direct interaction direct interaction HCT116 BAK/BAX double knock out cells reconstituted to express BAK. BAX dimers and multimers are formed in response to DNA damage. 1b, 1c. Etoposide and UV radiation Using X-Linker 1, 6-bismaleimidohexane (BMH), trimers and higher order complexes were seen. bak1-bak1-2 1 4 unspecified role unspecified role neutral component neutral component Q16611:p.Tyr110Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 15:35:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr110glu' Tue Jun 30 17:30:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr110Glu' direct interaction direct interaction HCT116 BAK/BAX double knock out cells reconstituted to express BAK. BAX dimers and multimers are formed in response to DNA damage. 1b, 1c. Etoposide and UV radiation Using BMOE (Bismaleimidoethane) only dimers were seen.