IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ HnRNP A1/A2 and SF2/ASF regulate alternative splicing of interferon regulatory factor-3 and affect immunomodulatory functions in human non-small cell lung cancer cells. HnRNP A1/A2 and SF2/ASF regulate alternative splicing of interferon regulatory factor-3 and affect immunomodulatory functions in human non-small cell lung cancer cells. PloS one 2012 imex curation Guo R., Li Y., Ning J., Sun D., Lin L., Liu X. Cancer - Interactions investigated in the context of cancer Dataset- IBD/Cancer? - I have not added anything... lxm2128@163.com 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Guo R., Li Y., Ning J., Sun D., Lin L., Liu X. Cancer - Interactions investigated in the context of cancer Dataset- IBD/Cancer? - I have not added anything... lxm2128@163.com Accepted 2016-NOV-29 AT 10:26 GMT AT 10:26 GMT by PPORRAS PloS one 2012 imex curation roa1_human Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 HNRPA1 Helix-destabilizing protein Single-strand RNA-binding protein hnRNP core protein A1 protein protein human Homo sapiens Human MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF DIP protein P09651 original sequence version: 176 A06683571C6C109F roa2_human Heterogeneous nuclear ribonucleoproteins A2/B1 HNRNPA2B1 HNRPA2B1 protein protein human Homo sapiens Human MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY DIP protein P22626 original sequence version: 152 DIP protein P22626 original sequence version: 159 4C2560A3D8E99D62 irf3_intron1_a1_binding_site_probe mrna messenger rna mRNA mrna human Homo sapiens Human UGAAAUAACUAGGGAAAGAGGAUG irf3_intron1_asf_binding_site_probe mrna messenger rna mRNA mrna human Homo sapiens Human ACGCUGGGGAAGGAUGUGCCAUGGAUAUGGGAAGGAACCCUAG irf3_intron1_a1_binding_site_probe-hnrnpa1-1 1 2 unspecified role unspecified role prey prey purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain G12C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G C chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 3C P22626 and P09651 increased the expression at RNA level of ENSG00000126456 Caus. from Fig 1 b/c P22626 and P09651 increased the expression at protein level of ENSG00000126456 irf3_intron1_asf_binding_site_probe-hnrnpa2b1-1 1 3 unspecified role unspecified role prey prey purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain G9C,G31C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G C certain certain sequence position certain certain certain sequence position certain G C chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 3C-2