IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Cancer Cell (1535-6108) 2013 imex curation Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Cancer Cell (1535-6108) 2013 imex curation Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Cancer Cell (1535-6108) 2013 imex curation Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Lysine-5 acetylation negatively regulates lactate dehydrogenase a and is decreased in pancreatic cancer. Cancer Cell (1535-6108) 2013 imex curation Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao D., Zou S.W., Liu Y., Zhou X., Mo Y., Wang P., Xu Y.H., Dong B., Xiong Y., Lei Q.Y., Guan K.L. Cancer - Interactions investigated in the context of cancer it is debatable if the other Kinase assays in Fig 1 and elsewhere should be included or not - I have not... The authors confirm that GST-HCS70, HA-HCS70 and LDH-A N6 acetyllysine are all of Human origin. yxiong@email.unc.edu,qlei@fudan.edu.cn,kuguan@ucsd.edu Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation nadh Nicotinamide adenine dinucleotide, reduced form small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pyruvate pyruvate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ldha_human L-lactate dehydrogenase A chain LDHA LDH muscle subunit Renal carcinoma antigen NY-REN-59 Cell proliferation-inducing gene 19 protein PIG19 protein protein human Homo sapiens Human MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF 401E8604CEB7F908 hsp7c_human Heat shock cognate 71 kDa protein HSPA8 HSC70 HSP73 HSPA10 Heat shock 70 kDa protein 8 Lipopolysaccharide-associated protein 1 protein protein human Homo sapiens Human MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 9AA27B210730670C ldha-nadh 1 5 cofactor cofactor coenzyme unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme unspecified role unspecified role c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 1I K5-acetylated LDH-A showed significantly lower activity when compared with the unacetylated LDH-A. hspa8-ldha 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lys5 n6aclys N6-acetyl-L-lysine (2S)-6-acetamido-2-aminohexanoic acid 6-acetylamino-2-aminohexanoic acid 6-acetylazanyl-2-aminohexanoic acid MOD_RES N6-acetyllysine N(zeta)-acetyllysine N6-acetyl-L-lysine N6-acetylated L-lysine epsilon-acetyllysine Acetyl Acetylation N6AcLys acetylk certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4G HSC70 C-terminal domain preferentially pulled down acetylated but not unacetylated LDH-A. ldha-hspa8 3 7 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lys5 n6aclys N6-acetyl-L-lysine (2S)-6-acetamido-2-aminohexanoic acid 6-acetylamino-2-aminohexanoic acid 6-acetylazanyl-2-aminohexanoic acid MOD_RES N6-acetyllysine N(zeta)-acetyllysine N6-acetyl-L-lysine N6-acetylated L-lysine epsilon-acetyllysine Acetyl Acetylation N6AcLys acetylk certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association Supp 4F The acetylated, but not the unacetylated, LDH-A could readily pull down endogenous HSC70. ldha-hspa8-1 2 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait P00338:p.Lys5Gln mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K Q Wed May 02 17:44:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys5gln' Tue Jun 30 20:21:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys5Gln' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4H, Supp 4G. The acetylation mimetic K5Q mutant displayed a much stronger interaction with HSC70 than the wild-type LDH-A. TSA ( Trichostatin A)and NAM (Nicotinamide) - deacetylase inhibitors. ldha-hspa8-2 4 7 unspecified role unspecified role bait bait lys-5 n6aclys N6-acetyl-L-lysine (2S)-6-acetamido-2-aminohexanoic acid 6-acetylamino-2-aminohexanoic acid 6-acetylazanyl-2-aminohexanoic acid MOD_RES N6-acetyllysine N(zeta)-acetyllysine N6-acetyl-L-lysine N6-acetylated L-lysine epsilon-acetyllysine Acetyl Acetylation N6AcLys acetylk certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4I TSA ( Trichostatin A)and NAM (Nicotinamide) - deacetylase inhibitors.