IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. Cancer Cell (1535-6108) 2013 imex curation Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. chIP-reChIP experiment - the bait of the first round of ChIP becomes a prey for the second IP. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Accepted 2013-JUN-03 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. Cancer Cell (1535-6108) 2013 imex curation Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-cwr22rv1 Homo sapiens cwr22rv1 Androgen-responsive human prostate carcinoma cell line CWR22Rv1 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Accepted 2013-JUN-03 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. Cancer Cell (1535-6108) 2013 imex curation Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Accepted 2013-JUN-03 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. Cancer Cell (1535-6108) 2013 imex curation Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIP assays using acetylated histone H3 antibody have not been included due to lack of antibody specificity. ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Accepted 2013-JUN-03 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. Cancer Cell (1535-6108) 2013 imex curation Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Accepted 2013-JUN-03 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. Cancer Cell (1535-6108) 2013 imex curation Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Accepted 2013-JUN-03 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. Cancer Cell (1535-6108) 2013 imex curation Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIPS:- It is not clear to which genomic region the antibodies are binding to - nor which primers were used - The authors sometime refer to "ARE region of PSA promoter" - yet the genomic location given for the "enhancer" primers in the Supplement is nowhere near the genomic location given for the "Promoter" primers ... so I have added "features" only as "ARE regions" and do not mention the promoter. (there are 3 AREs - two of which are in the proximal promoter and one is ~5 KB upstream (presumably the enhancer here) .) I have done the same for all the genes. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Accepted 2013-JUN-03 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation siah2_mouse E3 ubiquitin-protein ligase SIAH2 Siah2 Seven in absentia homolog 2 RING-type E3 ubiquitin transferase SIAH2 protein protein mouse Mus musculus Mouse MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ 1CB73AD3B4C9982F kpcd_human_gene KPCD_HUMAN_GENE gene gene human Homo sapiens Human ibp3_human_gene IBP3_HUMAN_GENE gene gene human Homo sapiens Human za2g_human_gene ZA2G_HUMAN_GENE gene gene human Homo sapiens Human stk39_human_gene STK39_HUMAN_GENE gene gene human Homo sapiens Human ppap_human_gene PPAP_HUMAN_GENE gene gene human Homo sapiens Human andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 scap_human_gene SCAP_HUMAN_GENE gene gene human Homo sapiens Human stea2_human_gene STEA2_HUMAN_GENE gene gene human Homo sapiens Human mt1x_human_gene MT1X_HUMAN_GENE gene gene human Homo sapiens Human fxyd3_human_gene FXYD3_HUMAN_GENE gene gene human Homo sapiens Human acbp_human_gene ACBP_HUMAN_GENE gene gene human Homo sapiens Human ncor1_human Nuclear receptor corepressor 1 NCOR1 KIAA1047 protein protein human Homo sapiens Human MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD DIP protein O75376 original sequence version: 186 DIP protein O75376 original sequence version: 75 DIP protein O75376 original sequence version: 153 DIP protein O75376 original sequence version: 147 DIP protein O75376 original sequence version: 112 DIP protein O75376-1 original sequence version: 111 DIP protein O75376 original sequence version: 146 1647FE060373A125 tmps2_human_gene Human TMPS2/TMPRSS2 gene gene gene human Homo sapiens Human nkx3.1_human_gene NKX31_HUMAN_GENE gene gene human Homo sapiens Human pde9a_human_gene PDE9A_HUMAN_GENE gene gene human Homo sapiens Human dopd_human_gene DOPD_HUMAN_GENE gene gene human Homo sapiens Human ndrg1_human_gene Human NDRG1 gene gene gene human Homo sapiens Human nep_human_gene NEP_HUMAN_GENE gene gene human Homo sapiens Human dhc24_human_gene DHC24_HUMAN_GENE gene gene human Homo sapiens Human dhso_human_gene DHSO_HUMAN_GENE gene gene human Homo sapiens Human pmepa_human_gene PMEPA_HUMAN_GENE gene gene human Homo sapiens Human ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB siah2_human E3 ubiquitin-protein ligase SIAH2 Seven in absentia homolog 2 SIAH2 RING-type E3 ubiquitin transferase SIAH2 protein protein human Homo sapiens Human MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP DIP protein O43255 original sequence version: 131 2D5DD845666EC924 klk3_human_gene Human kallikrein-related peptidase 3 (KLK3) (PSA) gene gene human Homo sapiens Human siah2-ar 5 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range lbd_including_af2_transactivation_domain sufficient to bind sufficient binding region sufficient to bind range range range range rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association 4E siah2-ar-1 3 14 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range sbd_domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined range range central_ring_zn_finger_domains sufficient to bind sufficient binding region sufficient to bind range range undetermined undetermined sequence position undetermined physical association physical association 4F siah2-klk3 2 31 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5B Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or NCOR1. siah2-klk3-1 2 31 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5B Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or NCOR1. siah2-klk3-2 2 31 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5B Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or NCOR1. siah2-klk3-3 4 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association 5A R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2. siah2-klk3-3 4 31 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Ai R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2. siah2-klk3-3 4 29 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association 5Aii R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2. siah2-klk3-4 4 31 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5A Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2, but not for the TMPRSS2 gene. siah2-klk3-5 4 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association 5C R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of AR and NCOR1 to the AREs of PSA was increased by knockdown of Siah2. ar-klk3-1 4 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association 5Ci R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of AR and NCOR1 to the AREs of PSA was increased by knockdown of Siah2. siah2-tmps2 2 14 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. siah2-klk3-6 2 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association 5Di Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. siah2-nkx3_1 2 14 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Dii Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. siah2-pmepa 2 14 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Diii Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-pmepa 2 20 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Div Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-klk3-1 2 20 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Dv Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-nkx3_1 2 20 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Dvi Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-siah2-2 7 8 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp 4A ar-klk3-1 1 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association 5H Siah2 interacted with AR and NCOR1 but not with p300 on the PSA gene. ar-klk3-1 1 20 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Hi Siah2 interacted with AR and NCOR1 but not with p300 on the PSA gene. ar-klk3-1 1 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association 5I NCOR1 and co-activator p300 are present in distinct AR complexes on the PSA gene. ar-ep300 1 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey association association 5Ii NCOR1 and co-activator p300 are present in distinct AR complexes on the PSA gene. siah2-klk3-7 4 32 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role bait bait association association 5J Knockdown of NCOR1 increased the amount of p300 binding, wheras knockdown of Siah2 decreased the amount of p300 binding. R1881 -Metribolone, a synthetic androgen. ar-ncor1-3 6 8 unspecified role unspecified role ancillary ancillary Q06986:p.[His99Ala;Cys102Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:19:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his99ala,cys102ala' Tue Jun 30 18:11:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His99Ala;Cys102Ala]' c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 20 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 5F A markedly higher association of Siah2 with the AR/NCOR1 complex is shown, rather than with AR alone. ar-siah2-1 6 8 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q06986:p.[His99Ala;Cys102Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:31:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his99ala,cys102ala' Tue Jun 30 17:45:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His99Ala;Cys102Ala]' 14 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P10275:p.Arg727Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R L Fri Jul 22 10:57:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg726leu' Wed May 02 16:25:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg727leu' Tue Jun 30 16:22:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg727Leu' P10275:p.Phe755Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F L Fri Jul 22 10:57:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe754leu' Wed May 02 18:52:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe755leu' Tue Jun 30 17:51:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe755Leu' P10275:p.Leu702His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L H Fri Jul 22 11:03:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu701his' Wed May 02 15:10:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu702his' Tue Jun 30 17:44:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu702His' P10275:p.Val716Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V M Fri Jul 22 11:04:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val715met' Wed May 02 14:56:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val716met' Tue Jun 30 16:40:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val716Met' P10275:p.His875Tyr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain H Y Fri Jul 22 11:02:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his874tyr' Wed May 02 16:23:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his875tyr' Tue Jun 30 18:40:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His875Tyr' P10275:p.Thr878Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Fri Jul 22 10:59:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr877ala' Wed May 02 17:36:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr878ala' Tue Jun 30 18:15:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr878Ala' P10275:p.Val731Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V M Fri Jul 22 11:14:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val730met' Wed May 02 15:47:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val731met' Tue Jun 30 16:56:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val731Met' P10275:p.Gln799Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q E Fri Jul 22 11:15:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln798glu' Wed May 02 16:52:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln799glu' Tue Jun 30 18:19:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln799Glu' physical association physical association 4A/4G, 5F, S4L. Two solvent-accessible surfaces on AR LBD are required for the interaction with Siah2. ar-ar-2 6 14 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range lbd_including_af2_transactivation_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q06986:p.[His99Ala;Cys102Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:31:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his99ala,cys102ala' Tue Jun 30 15:35:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His99Ala;Cys102Ala]' 14 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range af1_transactivation_domain sufficient to bind sufficient binding region sufficient to bind range range range range association association supp 5G Overexpression of Siah2 in 293T cells did not affect the AR intermolecular N-terminal and C-terminal interaction. siah2-nkx3_1-1 4 14 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association supp 5H R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ar-nkx3_1-1 4 22 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association supp 5Hi R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ncor1-nkx3_1 4 29 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association supp 5I R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ncor1-pmepa 4 29 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association supp 5Ii R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ar-tmps2-6 4 21 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5J Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-klk3-1 2 10 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-1 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ibp3 2 13 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-2 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-ibp3-1 2 14 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5L-3 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-kpcd 2 28 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-4 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dhso 2 15 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-5 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-scap 2 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5L-6 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-stk39 2 23 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-7 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-pde9a 2 14 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5L-8 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dhc24 2 14 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5L-9 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-fxyd3 2 24 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-10 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dopd 2 26 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-11 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-nep 2 14 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5L-12 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-stea2 2 14 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5L-13 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-ndrg1-2 2 17 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-14 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-mt1x 2 19 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-15 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-acbp 2 11 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp 5L-16 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ibp3-2 2 10 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association Supp 5M-1 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ppap 2 13 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association Supp 5M-2 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-kpcd-1 2 20 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-3 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-dhso-1 2 20 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-4 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-scap-1 2 20 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-5 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-stk39-1 2 20 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-6 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-pde9a-1 2 20 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-7 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dhc24-1 2 20 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-8 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-fxyd3-1 2 20 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-9 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dopd-1 2 24 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association Supp 5M-10 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-nep-1 2 20 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-11 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-stea2-1 2 20 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-12 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-ndrg1-3 2 25 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association Supp 5M-13 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-mt1x-1 2 20 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-14 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-acbp-1 2 19 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association Supp 5M-15 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-za2g 2 20 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5M-16 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ppap-1 2 13 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Supp 5N-2 ar-scap-2 2 15 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Supp 5N-5 ar-pde9a-2 2 31 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5N-7 ar-dhc24-2 2 31 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5N-8 ar-fxyd3-2 2 31 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5N-9 ar-dopd-2 2 31 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5N-10 ar-nep-2 2 31 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 5N-11 ar-stea2-2 2 16 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Supp 5N-12 ar-ndrg1-4 2 25 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Supp 5N-13 ar-mt1x-2 2 17 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Supp 5N-14 ar-acbp-2 2 19 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Supp 5N-15